Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364318 892 bp mRNA linear INV 14-MAY-2021 homolog, mitochondrial (LOC111072441), transcript variant X2, mRNA. ACCESSION XM_022364318 VERSION XM_022364318.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364318.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..892 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..892 /gene="LOC111072441" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111072441" CDS 110..502 /gene="LOC111072441" /codon_start=1 /product="iron-sulfur cluster assembly 1 homolog, mitochondrial isoform X2" /protein_id="XP_022220010.1" /db_xref="GeneID:111072441" /translation="MATRVVATATVRAVKGRKLIPTRAALTLTPAAVNRIKSLLQDKP DFIGLKVGVRQRGCNGLSYTLDYASSKDKLDEEVVQDGVKVFIDKKAQLSLLGTEMDF VESKLSSEFVFNNPNIKGTCGCGESFSM" misc_feature 182..499 /gene="LOC111072441" /note="Fe-S cluster assembly iron-binding protein IscA [Posttranslational modification, protein turnover, chaperones]; Region: IscA; COG0316" /db_xref="CDD:440085" ORIGIN 1 tatcgaaatt tctgtcagct ctaccaaaac agtcgcaatc acatattttt cgaatcgcaa 61 atcgttggaa tttcagggag aaaaacaaat tatataaagc aaatacgcaa tggcaacacg 121 tgtggtggca acggcaacgg tgcgcgccgt aaagggacga aaattgatac ccacgcgggc 181 ggccctgacc ctgaccccgg ctgcagtgaa ccgcattaag agcctgctgc aggacaagcc 241 agactttatt ggcctgaagg tgggcgtgcg acagcgcggc tgcaacggcc tctcctacac 301 cctggactat gccagcagca aagacaaact ggacgaggag gtggtccagg acggcgtgaa 361 ggtattcatt gacaagaagg cgcagctctc attgctaggc actgaaatgg actttgtgga 421 gtcgaagctg tccagcgagt ttgtgttcaa caatccgaac atcaagggca cctgcggctg 481 tggcgagtcg ttcagcatgt aaactctggc tctggagccg gcaacacccg cctcgcagcc 541 ccccgcccca ccccccaaag cgtatgccta acgaagatca gatgcagatc ctaccccagc 601 atgccccaag catctctcat ttctgttggc aggctgtata ctcgatgtaa aatctatttt 661 cgcaaacgaa tgctaaagtt aagttgtgtt ctctgtagtt caaatttagt tgtatattga 721 taaaaggatt taggctctag gcaatcatcc aatgtctagg cgaattacat agttcaatct 781 gaacgataag tgcgcccgct ttggtttgct tcgcggggcc cgcgcctatt ttgcacatta 841 tttgactcgg acacctagtt gaatacacaa acaaggaatg ttctagaaca aa