Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura iron-sulfur cluster assembly 1


LOCUS       XM_022364318             892 bp    mRNA    linear   INV 14-MAY-2021
            homolog, mitochondrial (LOC111072441), transcript variant X2, mRNA.
ACCESSION   XM_022364318
VERSION     XM_022364318.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364318.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..892
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..892
                     /gene="LOC111072441"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 11 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072441"
     CDS             110..502
                     /gene="LOC111072441"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly 1 homolog,
                     mitochondrial isoform X2"
                     /protein_id="XP_022220010.1"
                     /db_xref="GeneID:111072441"
                     /translation="MATRVVATATVRAVKGRKLIPTRAALTLTPAAVNRIKSLLQDKP
                     DFIGLKVGVRQRGCNGLSYTLDYASSKDKLDEEVVQDGVKVFIDKKAQLSLLGTEMDF
                     VESKLSSEFVFNNPNIKGTCGCGESFSM"
     misc_feature    182..499
                     /gene="LOC111072441"
                     /note="Fe-S cluster assembly iron-binding protein IscA
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IscA; COG0316"
                     /db_xref="CDD:440085"
ORIGIN      
        1 tatcgaaatt tctgtcagct ctaccaaaac agtcgcaatc acatattttt cgaatcgcaa
       61 atcgttggaa tttcagggag aaaaacaaat tatataaagc aaatacgcaa tggcaacacg
      121 tgtggtggca acggcaacgg tgcgcgccgt aaagggacga aaattgatac ccacgcgggc
      181 ggccctgacc ctgaccccgg ctgcagtgaa ccgcattaag agcctgctgc aggacaagcc
      241 agactttatt ggcctgaagg tgggcgtgcg acagcgcggc tgcaacggcc tctcctacac
      301 cctggactat gccagcagca aagacaaact ggacgaggag gtggtccagg acggcgtgaa
      361 ggtattcatt gacaagaagg cgcagctctc attgctaggc actgaaatgg actttgtgga
      421 gtcgaagctg tccagcgagt ttgtgttcaa caatccgaac atcaagggca cctgcggctg
      481 tggcgagtcg ttcagcatgt aaactctggc tctggagccg gcaacacccg cctcgcagcc
      541 ccccgcccca ccccccaaag cgtatgccta acgaagatca gatgcagatc ctaccccagc
      601 atgccccaag catctctcat ttctgttggc aggctgtata ctcgatgtaa aatctatttt
      661 cgcaaacgaa tgctaaagtt aagttgtgtt ctctgtagtt caaatttagt tgtatattga
      721 taaaaggatt taggctctag gcaatcatcc aatgtctagg cgaattacat agttcaatct
      781 gaacgataag tgcgcccgct ttggtttgct tcgcggggcc cgcgcctatt ttgcacatta
      841 tttgactcgg acacctagtt gaatacacaa acaaggaatg ttctagaaca aa