PREDICTED: Drosophila obscura iron-sulfur cluster assembly 1

LOCUS       XM_022364317             895 bp    mRNA    linear   INV 14-MAY-2021
            homolog, mitochondrial (LOC111072441), transcript variant X1, mRNA.
ACCESSION   XM_022364317
VERSION     XM_022364317.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364317.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..895
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..895
                     /gene="LOC111072441"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072441"
     CDS             110..505
                     /gene="LOC111072441"
                     /codon_start=1
                     /product="iron-sulfur cluster assembly 1 homolog,
                     mitochondrial isoform X1"
                     /protein_id="XP_022220009.1"
                     /db_xref="GeneID:111072441"
                     /translation="MATRVVATATVRAVKGRKLIPTRAALTLTPAAVNRIKSLLQDKP
                     DFIGLKVGVRQRGCNGLSYTLDYASSKADKLDEEVVQDGVKVFIDKKAQLSLLGTEMD
                     FVESKLSSEFVFNNPNIKGTCGCGESFSM"
     misc_feature    182..502
                     /gene="LOC111072441"
                     /note="Fe-S cluster assembly iron-binding protein IscA
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IscA; COG0316"
                     /db_xref="CDD:440085"
ORIGIN      
        1 tatcgaaatt tctgtcagct ctaccaaaac agtcgcaatc acatattttt cgaatcgcaa
       61 atcgttggaa tttcagggag aaaaacaaat tatataaagc aaatacgcaa tggcaacacg
      121 tgtggtggca acggcaacgg tgcgcgccgt aaagggacga aaattgatac ccacgcgggc
      181 ggccctgacc ctgaccccgg ctgcagtgaa ccgcattaag agcctgctgc aggacaagcc
      241 agactttatt ggcctgaagg tgggcgtgcg acagcgcggc tgcaacggcc tctcctacac
      301 cctggactat gccagcagca aagcagacaa actggacgag gaggtggtcc aggacggcgt
      361 gaaggtattc attgacaaga aggcgcagct ctcattgcta ggcactgaaa tggactttgt
      421 ggagtcgaag ctgtccagcg agtttgtgtt caacaatccg aacatcaagg gcacctgcgg
      481 ctgtggcgag tcgttcagca tgtaaactct ggctctggag ccggcaacac ccgcctcgca
      541 gccccccgcc ccacccccca aagcgtatgc ctaacgaaga tcagatgcag atcctacccc
      601 agcatgcccc aagcatctct catttctgtt ggcaggctgt atactcgatg taaaatctat
      661 tttcgcaaac gaatgctaaa gttaagttgt gttctctgta gttcaaattt agttgtatat
      721 tgataaaagg atttaggctc taggcaatca tccaatgtct aggcgaatta catagttcaa
      781 tctgaacgat aagtgcgccc gctttggttt gcttcgcggg gcccgcgcct attttgcaca
      841 ttatttgact cggacaccta gttgaataca caaacaagga atgttctaga acaaa