PREDICTED: Drosophila obscura DNL-type zinc finger protein

LOCUS       XM_022364315             444 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072440), transcript variant X2, mRNA.
ACCESSION   XM_022364315
VERSION     XM_022364315.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364315.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..444
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..444
                     /gene="LOC111072440"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 15 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072440"
     CDS             142..423
                     /gene="LOC111072440"
                     /codon_start=1
                     /product="DNL-type zinc finger protein isoform X2"
                     /protein_id="XP_022220007.1"
                     /db_xref="GeneID:111072440"
                     /translation="MQLIYTCKICQTRNMKTISKVAYQRGVVIVTCEGCANHHLIADN
                     LNWFTDLNGKRNIEEILAEKGEKVIKMVDGNCEFLPNPDSEHNKPKPNP"
     misc_feature    145..342
                     /gene="LOC111072440"
                     /note="DNL zinc finger; Region: zf-DNL; pfam05180"
                     /db_xref="CDD:461571"
ORIGIN      
        1 tgatcctgtt tggaccggca cgaaaagatg cacgtgcagt ggcacgcgac tcctgagcag
       61 cagcagcagt agcagcaaac cagtcatgca ggagacaaca aggctaccaa cagcattccc
      121 ctgggcgagc tgcaaacgaa aatgcagctc atttacacct gcaagatctg ccagacgcgc
      181 aacatgaaga ccatttcaaa ggttgcctat cagcgcggcg tcgtgatcgt gacgtgcgag
      241 ggctgtgcca atcatcacct gatagccgac aatctgaatt ggttcacgga tctgaacggc
      301 aagcgtaata ttgaggagat tctggccgaa aaaggcgaga aggtgatcaa aatggttgac
      361 ggaaactgcg aatttctgcc caatcccgat tccgaacaca ataaaccaaa accgaatcct
      421 taactgtaca caaaagcaac ttta