PREDICTED: Drosophila obscura DNL-type zinc finger protein

LOCUS       XM_022364314             711 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072440), transcript variant X1, mRNA.
ACCESSION   XM_022364314
VERSION     XM_022364314.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364314.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..711
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..711
                     /gene="LOC111072440"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072440"
     CDS             114..692
                     /gene="LOC111072440"
                     /codon_start=1
                     /product="DNL-type zinc finger protein isoform X1"
                     /protein_id="XP_022220006.2"
                     /db_xref="GeneID:111072440"
                     /translation="MSTFRQLYRLSAGLGQRVIQVTTRIALNEARTHRQLQLQFPTSR
                     LASTTTADPVWTGTKRCTCSGTRLLSSSSSSSKPVKDAGDNKATNSIPLGELQTKMQL
                     IYTCKICQTRNMKTISKVAYQRGVVIVTCEGCANHHLIADNLNWFTDLNGKRNIEEIL
                     AEKGEKVIKMVDGNCEFLPNPDSEHNKPKPNP"
     misc_feature    414..611
                     /gene="LOC111072440"
                     /note="DNL zinc finger; Region: zf-DNL; pfam05180"
                     /db_xref="CDD:461571"
ORIGIN      
        1 agcatataaa tttattccat cactaggtgg tgctgtaaca gctgtgcaaa agttcatctc
       61 taaatagtgt atttcgtgta cttctctttc aattaataat attttttggc aaaatgagca
      121 ctttcaggca gttgtacaga ctttctgctg gcttgggcca gcgcgtgata caagttacaa
      181 caagaatagc attaaatgag gcacgcacgc acaggcagtt gcagttgcaa tttcccactt
      241 cgagactggc atccaccaca acagctgatc ctgtttggac cggcacgaaa agatgcacgt
      301 gcagtggcac gcgactcctg agcagcagca gcagtagcag caaaccagtc aaagatgcag
      361 gagacaacaa ggctaccaac agcattcccc tgggcgagct gcaaacgaaa atgcagctca
      421 tttacacctg caagatctgc cagacgcgca acatgaagac catttcaaag gttgcctatc
      481 agcgcggcgt cgtgatcgtg acgtgcgagg gctgtgccaa tcatcacctg atagccgaca
      541 atctgaattg gttcacggat ctgaacggca agcgtaatat tgaggagatt ctggccgaaa
      601 aaggcgagaa ggtgatcaaa atggttgacg gaaactgcga atttctgccc aatcccgatt
      661 ccgaacacaa taaaccaaaa ccgaatcctt aactgtacac aaaagcaact t