Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364313 1251 bp mRNA linear INV 14-MAY-2021 (LOC111072439), mRNA. ACCESSION XM_022364313 VERSION XM_022364313.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364313.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1251 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1251 /gene="LOC111072439" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111072439" CDS 196..1236 /gene="LOC111072439" /codon_start=1 /product="uncharacterized protein LOC111072439" /protein_id="XP_022220005.2" /db_xref="GeneID:111072439" /translation="MDAFIRKELILNAGTSLENVAPHCIKLLDWLLDCQVEIQSQQKL LKLTPNLIESIMKATMYLFECHDRFGEALAERCNSQSFYATCSTLAERKQSIKELCAS IVKTRKGESHAALLHLMHKPFADVQPAWSVIKELDWAAMRQPAAFDPAQMVSTDLLQM RRLVKRICRLSTLQKMETALHRALELVGFSVWLCLFREPRQSNIHSDCHLLRHMICDM LAEGEAQTGPCCGFLHNMYLFVANPANELRFWACLDHARLPGSLIAYLIGYWNRHMPY LDLDDMQITADAPPPVGACPPLPLDEVTFLTHLLLTPRSPCREQFYLQLRPHAMTSQL MELLNKVAFVYS" ORIGIN 1 ttcgcatcat ctcattaatg aatttaattt aatatagcaa cgaaaaacag caaacgatgg 61 gagtgaattc gatttcaagc aggcagcagg atatcgatct agccgatatc ttcttgaaaa 121 tgagttggca gcgccaaaat taaaatatca acaaattctt ggtttaaaaa atggtgccgc 181 tggcgttgac tgggcatgga tgcgtttatt agaaaggagc tgatcctcaa tgctggcaca 241 agcctcgaaa atgtcgcccc gcactgcatc aaactactgg actggctgct ggactgccag 301 gtggagatcc aatcacaaca gaagctcctc aagctgacgc caaatctaat cgaatcaata 361 atgaaggcca ccatgtacct gttcgagtgc catgaccgct tcggtgaggc tctcgcggag 421 cgctgcaact cccaaagttt ctacgccaca tgctccacac tggcggaacg caaacagagc 481 atcaaggagc tgtgtgccag catagtaaag acaagaaagg gcgagtcaca tgccgcattg 541 ctgcacttga tgcacaagcc gtttgcggac gtgcaaccgg cgtggagcgt catcaaggag 601 ctggactggg cagcaatgcg tcagccggct gcattcgacc ctgcgcaaat ggtcagcact 661 gatctcctgc aaatgcgtcg cctggttaag cgcatctgtc gtctgtccac gctgcagaaa 721 atggaaactg ccctgcaccg tgccctagag ctggtcggct tcagtgtgtg gctgtgtcta 781 ttccgtgagc cacggcagag caacatacac tcggactgcc atctgctgcg ccacatgatc 841 tgtgatatgc tggccgaggg cgaggcccag actggcccct gctgtggctt cctgcacaac 901 atgtacctct ttgtggcgaa cccagccaat gagttgcgat tctgggcctg tctggaccat 961 gcccgtctgc ccggtagcct cattgcctac ttgattgggt actggaatcg ccacatgccc 1021 tacttggacc tggacgacat gcaaatcacg gccgatgctc cacccccggt cggcgcctgc 1081 ccgccgctgc cactagacga agtgacattt ctcacccacc tcctgctgac gccacgatcg 1141 ccctgccgcg agcaattcta tctgcaattg cgaccacatg ccatgaccag ccagctgatg 1201 gagctcctca ataaagttgc ttttgtgtac agttaaggat tcggttttgg t