Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura ubiquitin-conjugating enzyme E2 H


LOCUS       XM_022364307            1061 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072435), transcript variant X3, mRNA.
ACCESSION   XM_022364307
VERSION     XM_022364307.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364307.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1061
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1061
                     /gene="LOC111072435"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 16 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072435"
     CDS             356..907
                     /gene="LOC111072435"
                     /codon_start=1
                     /product="ubiquitin-conjugating enzyme E2 H"
                     /protein_id="XP_022219999.1"
                     /db_xref="GeneID:111072435"
                     /translation="MSSPSAGKRRMDNDVIKLIESKHEVTILGGLNEFHVKFFGPSET
                     PYEGGVWKVRVYLPDNYPFKSPSIGFVNKIYHPNIDESSGTVCLDVINQAWTALYDLS
                     NIFESFLPQLLTYPNPVDPLNRDAAALYLHEPEEYHRKVADYVQRYATEDALRAAQQE
                     RESSDSESSMSDYSEDEARDMEL"
     misc_feature    380..790
                     /gene="LOC111072435"
                     /note="Ubiquitin-conjugating enzyme E2, catalytic (UBCc)
                     domain of ubiquitin-conjugating enzyme E2 H and related
                     proteins; Region: UBCc_UBE2H; cd23797"
                     /db_xref="CDD:467417"
ORIGIN      
        1 cagcagtaat cgcaagtaaa tgcagcaacc cccttgcgac gtttctgatt gcgctggatc
       61 gcgtgtgtga gagttgacga atgcggatga aggagccgtg caacaggaag cggaaagcag
      121 gagaatagca ccacaaacag gaaccggaac agcaataaca acatttacaa tatacaaaaa
      181 attaaaaaca aattgaaggg aaagaaagga acaaataaac aaacaccgcc ttagccttag
      241 tgaaatacaa cgacaagaag cggacaatag agatcgagac cgccctcatc aaagagcact
      301 atcctatccg tatctaatca caacacaaag tcaatcaaaa gctacagcta aaaaaatgtc
      361 gtcgcccagt gctggaaaac gtcgcatgga caatgacgtg atcaaactga ttgaatcaaa
      421 acacgaggtc accattctcg ggggcctcaa cgagttccat gtgaaattct tcggcccgtc
      481 ggaaacacct tacgagggcg gtgtgtggaa ggttcgcgtc tatctgcccg ataactatcc
      541 cttcaagtcg ccgagcattg ggttcgtgaa caagatctat catccgaata ttgacgaatc
      601 gtctgggacg gtctgtctag atgtgatcaa tcaggcctgg acggccctgt acgacctatc
      661 gaacatattc gagtcgtttt tgccgcagct gctcacatat ccgaatccgg tggatccgct
      721 caatcgggat gctgccgccc tgtacctgca cgagccggaa gagtatcatc gcaaggtggc
      781 cgactatgtg caacgctatg ccaccgaaga tgcgctgcgg gcggcgcaac aggagcgaga
      841 gagcagcgac agcgagtcga gcatgtccga ctacagtgag gatgaggcac gggacatgga
      901 gttataatat cggtttaact ctaatcaaat accattaaca ttaacgacaa atgcctaata
      961 ctaatgcttt agcgcagctc ttctctctct ctctctttct ctcgctctgc atcctctgcc
     1021 tttttggata tgacgatgat ctttcaaatc agcaaatcaa c