PREDICTED: Drosophila obscura EF-hand calcium-binding

LOCUS       XM_022364304            1131 bp    mRNA    linear   INV 14-MAY-2021
            domain-containing protein 1 (LOC111072434), transcript variant X1,
            mRNA.
ACCESSION   XM_022364304
VERSION     XM_022364304.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364304.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1131
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1131
                     /gene="LOC111072434"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 5 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072434"
     CDS             41..1120
                     /gene="LOC111072434"
                     /codon_start=1
                     /product="EF-hand calcium-binding domain-containing
                     protein 1 isoform X1"
                     /protein_id="XP_022219996.2"
                     /db_xref="GeneID:111072434"
                     /translation="MCPKGQGTRFNASAWSLSGNQNNNNLDMGKAGATKGRSPTPTPN
                     RDNVGGGTVAGAGVVVAAGAGGGGGGGGGGAATTSSGAGATTAGRSTLHANKTILKTV
                     SVFLASGKRNSSNQQSKAAAAALQKKRQQRQRRMEELSGKINPKLLDSLRKKTRFSKD
                     ELDALCRIYRKLVSNCQYAAKTLASSSSSAAIAKPHAAVEGIDRIVFRELLHSTFDIV
                     TEEILMERIFCSWDKAHEGLPLRLEGWLIGLSTFLRGTSTERAGFCFRVYDLNQDGFI
                     TKDEMFTLLRNCLIKQPQDEDPDEGVKDLVEIVLKKFDLDKDGKVSLEDFMATVTAEP
                     LLIEAFGQCLPTDSAVGSFFSTLQV"
     misc_feature    <452..1024
                     /gene="LOC111072434"
                     /note="transaldolase; Region: PRK12309"
                     /db_xref="CDD:183426"
     misc_feature    815..1024
                     /gene="LOC111072434"
                     /note="EF-hand domain pair; Region: EF-hand_7; pfam13499"
                     /db_xref="CDD:463900"
ORIGIN      
        1 ttgttgattc cttttgtttt ggcccgtttg ccatttgtgg atgtgcccaa agggccaagg
       61 gacacgcttt aacgcctctg cgtggagtct atcgggcaat caaaataaca acaacctaga
      121 catgggcaaa gcaggcgcca ccaagggtcg ttcgccaacg ccgacaccca atcgtgataa
      181 tgttgggggc ggaactgtgg ctggagccgg agtcgtagtc gctgctggag ctggaggggg
      241 aggcggcggt ggtggtggtg gtgcagcaac aacatcaagc ggtgccggag caacaacagc
      301 cggcagatcc acactacatg cgaacaaaac gatactgaaa acggtctcgg tattcctcgc
      361 cagcggcaaa cgtaactcga gcaaccaaca gtcaaaagcc gccgcggcgg ccctgcagaa
      421 aaagcggcag cagcgccaaa ggagaatgga ggagctaagc ggcaaaatca atccaaagct
      481 gctggacagt ttgcgcaaga agacgcgctt cagcaaagac gaactggatg ctctgtgccg
      541 tatctatcgg aagctcgtgt ccaactgcca gtatgcggcc aagacgctgg cctccagctc
      601 ttccagtgcg gccatagcga agccccatgc agccgtggag ggcatcgacc gaattgtgtt
      661 ccgtgagctg ttgcacagca ccttcgatat tgtcaccgag gagatactga tggagcgcat
      721 cttttgcagc tgggacaagg cacacgaggg cctgcccctg cggctcgagg gctggctcat
      781 cggcctctca acgtttctgc gcggcacgtc cacggagcgg gcgggcttct gctttcgggt
      841 gtacgacctc aatcaggacg gtttcattac caaggatgag atgttcacgc tgctgcgcaa
      901 ctgtctgatc aagcagccgc aggacgagga tcccgacgag ggtgtcaagg atctggtgga
      961 gatcgtactc aagaaattcg acctggacaa ggatggcaag gtgtcgctgg aggacttcat
     1021 ggccacagtc accgccgaac cgctgctgat tgaagccttt ggccagtgcc tgcccacgga
     1081 cagtgctgtc gggtcctttt tctcaacgct acaggtgtaa atcgaatcga a