Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364301 1312 bp mRNA linear INV 14-MAY-2021 (LOC111072433), mRNA. ACCESSION XM_022364301 VERSION XM_022364301.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364301.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1312 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1312 /gene="LOC111072433" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111072433" CDS 211..615 /gene="LOC111072433" /codon_start=1 /product="uncharacterized protein LOC111072433" /protein_id="XP_022219993.2" /db_xref="GeneID:111072433" /translation="MAGFLKTRKRSREDDLPCESTPLSKRINNLHLNYDDGNSSSSSS CSIPTQINDHNNYNTVPVIAGGPAAGATAVATPAAAAAAAGATNSIDILNGDGTIYGY NPELSADQNPYYYDKNKMLYDLHVERAKRNTH" ORIGIN 1 cacagatcac tttagaaaag cactgtctag ctgaggcagc agtagctaca gcagcttttt 61 taaaattatt tattcgatct ttttttatca tcgtgtcaag aactacgcaa cactgttctt 121 tggcatacgc agtcacactg ccaaagcagc ccgtgaaaag aacaacagag ataggggacc 181 agctagctaa tttgctggct aaagaacgga atggctggat ttctaaagac aagaaaacgc 241 agtcgtgaag atgacctgcc atgcgagtcc acgcccctct ccaagcgaat caacaatctt 301 catttgaact acgacgatgg gaacagcagc agcagcagca gctgcagtat tccgactcag 361 ataaatgacc acaacaatta caatacagtg cctgtgatcg ctggtggacc tgcagctgga 421 gccacagccg tcgccacacc agcagcagca gcggcggcgg ccggggctac taattcgatt 481 gatatcctaa atggagacgg aaccatatat ggatacaatc cggagctaag tgccgaccaa 541 aatccctatt actatgataa gaacaaaatg ctatatgacc tgcatgtcga gcgtgccaag 601 cgaaacactc actaaactta gtatgtatag gcagaatgat taggatggac ttttggcatg 661 ctgtctgaaa ctttaaataa accgatacac aacaccactt atagcttcaa atacacactt 721 tttgcaggga taattgcact tgccatagca cgcaagttca cacacaccca cctacacaca 781 aacacacaca cacacacaat caatcaaata caagagaaaa gagtgccaat cgaagctcag 841 attgcatggc caagtccgaa cttgtatcgt tttgtaattg tactgttatg gtagttatta 901 ataataatgt tattctgtgt gtggagtgac gacccacgga cccaagctgc tcatgtaagc 961 ttaaatcgct aagaactaag acaaaatata catctaaatt ttccattcgt tcacatttag 1021 tctaagcatt tattgtatga tagttcattt agttgtaacc aagtacatat attaagattt 1081 gagaagtcga aagttttttg aattttggcg ctttgacagt gtcatgtaac aagtcttgcg 1141 acgtccatca ttttgcagca ctgacattaa atagttagtc tcgtatcgga gaggagcgtt 1201 tatatatgtc ttcaaaatat atccagcaat caaattcgtt atatatcaaa aatgtaatac 1261 aatcaacaaa ttatgaattg tgaaatagat gtaatgaaaa tatacaaaaa ta