Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura acidic phospholipase A2 PA4


LOCUS       XM_022364282            1176 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072428), mRNA.
ACCESSION   XM_022364282
VERSION     XM_022364282.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364282.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1176
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1176
                     /gene="LOC111072428"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 11 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 7 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072428"
     CDS             87..839
                     /gene="LOC111072428"
                     /codon_start=1
                     /product="acidic phospholipase A2 PA4"
                     /protein_id="XP_022219974.2"
                     /db_xref="GeneID:111072428"
                     /translation="MDRCRAGRCGFSGRTMKEALPLAVLLLWLGSALPPSSGSAVLIS
                     DMTMTVMVELSSRHPFCKMHRDRGDIQRMLLQSDPRRIRQVPRESVMELEEVCRHQGS
                     YGHEFRGALGFIYPGTKWCGPGTAATSYDDLGAHTREDRCCREHDMCPDVLNVGECRR
                     GLCNRGTFTRSHCDCDARFRRCLQAANTETANTLGAIFYNVVQVTCFQERSPCSAHQR
                     AGYNETEQEAICAQWQYQPSEKYVPSQPRTSS"
     misc_feature    423..713
                     /gene="LOC111072428"
                     /note="A sub-family of Phospholipase A2, similar to bee
                     venom PLA2. PLA2 is a super-family of secretory and
                     cytosolic enzymes; the latter are either Ca dependent or
                     Ca independent. Enzymatically active PLA2 cleaves the sn-2
                     position of the glycerol backbone of...; Region:
                     PLA2_bee_venom_like; cd04704"
                     /db_xref="CDD:153093"
     misc_feature    order(444..446,450..452,456..458,525..527)
                     /gene="LOC111072428"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153093"
     misc_feature    order(522..524,612..614,678..680)
                     /gene="LOC111072428"
                     /note="catalytic site [active]"
                     /db_xref="CDD:153093"
ORIGIN      
        1 tgagaaaaag ggatcgaggg cccagggtga ctaaaggcgc tccattcgaa tggagctggc
       61 gacagtgtgg tgtgacgtcg tgggccatgg accggtgccg ggccggacgg tgcggattct
      121 ctgggaggac gatgaaggag gctctgccgt tggcggtgct gctgctgtgg ctaggatcgg
      181 cgctgccgcc cagctccgga tcggcggtgc tcatctcgga catgaccatg actgtgatgg
      241 tggagctctc gtcccggcat cccttctgca agatgcacag agatcgcggc gacatacaac
      301 ggatgctgct gcagtcggat ccacgacgca tccgccaggt gccgcgcgag tcggtaatgg
      361 agctggagga ggtgtgccgg catcagggct cctatggcca tgagttccgc ggcgccctgg
      421 gcttcatcta tccggggacc aagtggtgtg gccccggtac agcggccacc agctatgacg
      481 atctgggcgc ccatacgcgg gaggatcgct gttgtcgcga gcacgacatg tgcccggatg
      541 tcctgaatgt gggcgagtgc aggcggggat tgtgcaaccg gggtaccttc acccgctctc
      601 actgtgactg cgacgcgaga ttccggcgct gcctgcaggc ggccaacacg gagacggcca
      661 acacattggg cgcaatcttc tacaatgtgg tgcaggtgac gtgcttccag gagcgcagtc
      721 cctgctcggc gcaccagagg gctggctaca atgaaacgga acaggaggcc atatgtgccc
      781 agtggcagta ccagccctcg gagaagtacg tacccagtca gccgcgcact tcttcctaga
      841 cgatcaaagg gacggaaggg actgatggat gccgacctgg acaagctact catggaaacg
      901 gttacaaatc tacacaaagc aattacaatt acaaatgcaa ttacaattac aagtttagcc
      961 atagaatgtg cacagtcgta tcgatatgat actacatatt tccgcttttc ttaacctgat
     1021 ctgatgaacc tgaagccgac ctgaacctga acctgaatat gaatctgaat cctgaaccaa
     1081 agccaatgcc aaagttcaag caacagcatg gaaactaaat aggaaaatat atacatatat
     1141 tttcatatat ttagagcata caacaaaaac agatct