Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364274 1641 bp mRNA linear INV 14-MAY-2021 (LOC111072423), mRNA. ACCESSION XM_022364274 VERSION XM_022364274.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364274.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1641 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1641 /gene="LOC111072423" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111072423" CDS 74..1615 /gene="LOC111072423" /codon_start=1 /product="transcription factor grauzone" /protein_id="XP_022219966.2" /db_xref="GeneID:111072423" /translation="MICRLCLEDAQHSVPIFDGVDSPMQPSLSNLAELIEKHLQLVLM PNDAVSKCLCTKCWQQLADFEQFCAMVMKKQLGLPLKLEPFSDDDEDTKAQILCEPEI DVSPSADTNEYNEIDIDTKPLPSSGRTTTRRRVRLPSPIRRSMRPRAAQKARPLKAKP KRHLESELDIAGSSNSGEMDSYIAAHGRLECCQCGGDSQYHNFAELKRHYRNEHQTAG YVMCCQRRYKKRALYVDHLRMHNDPDYFRCKICAKQLVSRISYDVHMLRFHSNEDELS FACDKCSKRFSKQFLLTIHARVHQQERTEKCKHCDRSFRTAVDLRLHMRRTHDPTFVP FICDSCGSKFKTKQNLLVHKRTVHREGSQLPEVQCQECQTWLSDENSLRKHMYMHRDA ASTREWKCGQCGLVKDSRAKLAAHIRYHHPKEYHKCTHCGKEFKSSRGLEEHTATHTG QDLYECAFCERTFKNSGNMHKHRRQMHAAQVAALQQQKKVRPSKRKEKGSLLLLDEGD NEIND" misc_feature 77..298 /gene="LOC111072423" /note="Zinc-finger associated domain (zf-AD); Region: zf-AD; pfam07776" /db_xref="CDD:462262" misc_feature 740..793 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 815..880 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 908..970 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(923..925,929..931,935..937,941..946,953..958, 965..967,1007..1009,1013..1015,1025..1030,1037..1042, 1052..1054,1097..1099,1103..1105,1109..1111,1115..1120, 1127..1132,1139..1141) /gene="LOC111072423" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 989..>1174 /gene="LOC111072423" /note="N-terminal domain of Oryza sativa transcription factor SUPPRESSOR OF FRI 4 (OsSUF4), Arabidopsis thaliana SUF4 (AtSUF4), and similar proteins; Region: SUF4-like; cd20908" /db_xref="CDD:411020" misc_feature 992..1057 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:411020" misc_feature 992..1057 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1007..1009,1025..1027,1046..1048,1052..1054, 1079..1081,1100..1102) /gene="LOC111072423" /note="putative DNA binding site [nucleotide binding]; other site" /db_xref="CDD:411020" misc_feature 1082..1147 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:411020" misc_feature 1082..1141 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1178..1240 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1271..1333 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature order(1286..1288,1292..1294,1298..1300,1304..1309, 1316..1321,1328..1330,1370..1372,1376..1378,1388..1393, 1400..1405,1412..1414,1454..1456,1460..1462,1466..1468, 1472..1477,1484..1489) /gene="LOC111072423" /note="putative nucleic acid binding site [nucleotide binding]; other site" /db_xref="CDD:275368" misc_feature 1355..1417 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" misc_feature 1439..1495 /gene="LOC111072423" /note="C2H2 Zn finger [structural motif]; Region: C2H2 Zn finger" /db_xref="CDD:275368" ORIGIN 1 gatagtgccc tcgatggttt gacacctcta ttgccttaat ttttaattaa atttttgctt 61 ccacatttat gaaatgatat gccgtctgtg tctcgaagat gcccagcaca gtgtccccat 121 ctttgacggc gtcgacagcc caatgcagcc atcgctgtcc aacctggccg aattgataga 181 gaaacacctg caattggttc tgatgcccaa cgatgctgta tccaagtgcc tgtgcaccaa 241 atgctggcag cagctggccg actttgaaca gttctgcgcc atggtgatga agaaacagct 301 ggggctgccg ctgaagctgg agcctttctc ggatgacgac gaggacacca aggcacagat 361 attgtgcgag ccagagattg atgtcagccc ctcggccgat acaaacgaat acaatgagat 421 cgacatagac acgaaaccac tgccaagcag tggcaggact acgaccaggc gaagggtacg 481 ccttccgtcg cccatacgcc gcagcatgcg tccccgggcc gcccagaagg ccagaccatt 541 gaaagcgaaa ccgaagcgtc accttgagtc ggagctggac atcgctggga gtagcaacag 601 cggcgaaatg gatagctaca ttgcggcaca cggtcgcctg gaatgctgtc agtgcggcgg 661 cgattcccag tatcacaact ttgccgagct caagcgacat tatcggaatg agcatcagac 721 ggccggatat gtgatgtgct gtcagaggcg ctacaagaag cgtgctctct acgtggacca 781 tctgcgaatg cacaacgatc cggattactt tagatgtaag atttgtgcga agcagctggt 841 cagcagaatc agctacgacg tgcacatgct gcggtttcat tccaacgagg acgagctgag 901 cttcgcctgc gacaagtgtt cgaagcggtt ttcaaagcaa ttcctgctga ccatccacgc 961 ccgtgtccac caacaggagc gcaccgaaaa gtgcaagcac tgcgacagat cattccgcac 1021 tgctgtcgat ttgcgcctgc acatgcgtcg cactcacgat cccacctttg tgcccttcat 1081 ctgcgactcc tgcggctcca agttcaagac gaagcaaaat ctcttggtac acaagcgcac 1141 cgtgcatcgg gagggctcac agctgccgga ggtgcagtgt caggaatgcc agacctggct 1201 gagcgacgag aacagcctgc gcaagcacat gtacatgcat cgcgatgcgg cgtccacgcg 1261 cgaatggaag tgtggacagt gcggcctagt gaaggactcg cgcgcaaagc ttgctgccca 1321 cattcggtat catcatccga aggagtatca caagtgcaca cactgcggga aggagttcaa 1381 gagcagtcgt ggcctcgagg agcacacggc cacacacacc ggccaggacc tgtacgagtg 1441 tgccttctgt gagcgcacct tcaagaattc gggcaacatg cacaagcacc gccggcagat 1501 gcatgccgcc caggttgccg cactgcagca gcagaaaaag gtacgtccga gcaagcggaa 1561 ggagaagggc tccctgctgc tcttggatga gggggataac gaaataaacg actgatcgat 1621 tccaaaataa actttacttt c