Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364262 1441 bp mRNA linear INV 14-MAY-2021 (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho (LOC111072416), mRNA. ACCESSION XM_022364262 VERSION XM_022364262.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364262.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1441 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1441 /gene="LOC111072416" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111072416" CDS 116..1318 /gene="LOC111072416" /codon_start=1 /product="tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho" /protein_id="XP_022219954.1" /db_xref="GeneID:111072416" /translation="MATIFFAEPELVIGHGRKVLFLNPGDLQIFKEIELPPDLTTCGL KTVEPVPVPGPGPSHPASSSKQQPAALREATGSVKVEVSIQNVTYSPDRQLLALTTVG QKAVLLYKSRPENAKLLSIRPLARASSALRFCSDGSSVLVTDKTGDCYQYDCVEVDAP PRLLLGHLSIVYDILWSEDQQYIITCDRDDKIRVTNYPATFDIHSYCLGHKEFVSGLA MLTEQHIISASGDKTLRVWNYTCGKEQLLHELPAPAVRMLVRQLEPEKTYEVAVLFYD HVDAIGVYRLEQTTKESWSITSTQLVRAEAGKWNICNFALTDDRIYVTGAENDRLTLR VYDSRNGERATGLPDGWLKMVLDNLDVAAFMPEDLSVWFKKRFDNVSDYLERKKRRIE EQKQQKCG" misc_feature 365..487 /gene="LOC111072416" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 500..1141 /gene="LOC111072416" /note="WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from...; Region: WD40; cl29593" /db_xref="CDD:475233" misc_feature 500..613 /gene="LOC111072416" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 626..721 /gene="LOC111072416" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 758..868 /gene="LOC111072416" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 tggcctgttg tccataccct catttttctt agaattttac ccagcgtttt gaagcaaaag 61 agaaagcaaa gaagaagaaa gcaaaagtaa tacggaacga acgtaggcgg taaacatggc 121 aacaattttt ttcgctgagc ccgagctggt tattggacac ggccgtaagg tgcttttcct 181 gaatccgggc gacttgcaaa tctttaagga aatcgaactg ccaccggatt taaccacgtg 241 tggattgaaa acggtcgagc cagtccccgt gcctggccca gggccgagcc acccggccag 301 cagctcaaag caacagcctg cagccttgag ggaagcaaca ggatctgtca aggtcgaggt 361 atcgatacaa aatgtgacct actctccaga tcgccaactg ttggctctga ccacagttgg 421 ccagaaggca gtgctgctat acaagagtcg acctgagaac gccaagctcc tctctatacg 481 cccactcgca cgtgcatcga gcgccctgag gttctgtagc gatggcagct ccgttctggt 541 caccgacaag actggtgatt gctatcagta tgactgtgtt gaggtggatg ctccgccacg 601 tttacttctg ggacatttga gcattgtgta tgacatcttg tggtcggagg accagcagta 661 tattatcaca tgtgaccgcg atgacaagat acgggtcacc aactatccgg caacgttcga 721 tatacacagt tattgcttgg gtcacaagga attcgtgtct ggcctggcaa tgctcacgga 781 acagcacatc atctcggcat cgggggacaa gacgctgcgg gtatggaact atacttgcgg 841 caaggagcag ctgctccacg agcttcccgc tccagctgtc cgaatgctgg tgcgtcagct 901 ggagcccgaa aagacatatg aggtggccgt gctcttctat gaccatgtgg atgcgattgg 961 cgtgtatcga ctggaacaga caaccaaaga gagttggagc atcacctcca cccaactggt 1021 gcgtgccgag gccggcaaat ggaatatatg caattttgca ttgaccgatg accggattta 1081 tgtgactggt gcggagaatg accgtctaac gttgcgggtg tacgacagca ggaatggcga 1141 gagggccact ggcctgccag acggttggct gaagatggtc ttagacaatc tagatgtggc 1201 cgcattcatg cccgaggact tgtctgtttg gtttaagaaa cgattcgaca atgtcagcga 1261 ttacttggag cgcaagaagc gtcgcatcga ggagcagaag cagcaaaaat gtggataatt 1321 tacatacttc ttatctttac atagcattta attagtttat cggacaaaat taacggacta 1381 tgtttgacaa atctgttaca tgaacatatt atattatatg cagatatata tatatatata 1441 t