Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura tRNA


LOCUS       XM_022364262            1441 bp    mRNA    linear   INV 14-MAY-2021
            (guanine-N(7)-)-methyltransferase non-catalytic subunit wuho
            (LOC111072416), mRNA.
ACCESSION   XM_022364262
VERSION     XM_022364262.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364262.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1441
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1441
                     /gene="LOC111072416"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111072416"
     CDS             116..1318
                     /gene="LOC111072416"
                     /codon_start=1
                     /product="tRNA (guanine-N(7)-)-methyltransferase
                     non-catalytic subunit wuho"
                     /protein_id="XP_022219954.1"
                     /db_xref="GeneID:111072416"
                     /translation="MATIFFAEPELVIGHGRKVLFLNPGDLQIFKEIELPPDLTTCGL
                     KTVEPVPVPGPGPSHPASSSKQQPAALREATGSVKVEVSIQNVTYSPDRQLLALTTVG
                     QKAVLLYKSRPENAKLLSIRPLARASSALRFCSDGSSVLVTDKTGDCYQYDCVEVDAP
                     PRLLLGHLSIVYDILWSEDQQYIITCDRDDKIRVTNYPATFDIHSYCLGHKEFVSGLA
                     MLTEQHIISASGDKTLRVWNYTCGKEQLLHELPAPAVRMLVRQLEPEKTYEVAVLFYD
                     HVDAIGVYRLEQTTKESWSITSTQLVRAEAGKWNICNFALTDDRIYVTGAENDRLTLR
                     VYDSRNGERATGLPDGWLKMVLDNLDVAAFMPEDLSVWFKKRFDNVSDYLERKKRRIE
                     EQKQQKCG"
     misc_feature    365..487
                     /gene="LOC111072416"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    500..1141
                     /gene="LOC111072416"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cl29593"
                     /db_xref="CDD:475233"
     misc_feature    500..613
                     /gene="LOC111072416"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    626..721
                     /gene="LOC111072416"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    758..868
                     /gene="LOC111072416"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 tggcctgttg tccataccct catttttctt agaattttac ccagcgtttt gaagcaaaag
       61 agaaagcaaa gaagaagaaa gcaaaagtaa tacggaacga acgtaggcgg taaacatggc
      121 aacaattttt ttcgctgagc ccgagctggt tattggacac ggccgtaagg tgcttttcct
      181 gaatccgggc gacttgcaaa tctttaagga aatcgaactg ccaccggatt taaccacgtg
      241 tggattgaaa acggtcgagc cagtccccgt gcctggccca gggccgagcc acccggccag
      301 cagctcaaag caacagcctg cagccttgag ggaagcaaca ggatctgtca aggtcgaggt
      361 atcgatacaa aatgtgacct actctccaga tcgccaactg ttggctctga ccacagttgg
      421 ccagaaggca gtgctgctat acaagagtcg acctgagaac gccaagctcc tctctatacg
      481 cccactcgca cgtgcatcga gcgccctgag gttctgtagc gatggcagct ccgttctggt
      541 caccgacaag actggtgatt gctatcagta tgactgtgtt gaggtggatg ctccgccacg
      601 tttacttctg ggacatttga gcattgtgta tgacatcttg tggtcggagg accagcagta
      661 tattatcaca tgtgaccgcg atgacaagat acgggtcacc aactatccgg caacgttcga
      721 tatacacagt tattgcttgg gtcacaagga attcgtgtct ggcctggcaa tgctcacgga
      781 acagcacatc atctcggcat cgggggacaa gacgctgcgg gtatggaact atacttgcgg
      841 caaggagcag ctgctccacg agcttcccgc tccagctgtc cgaatgctgg tgcgtcagct
      901 ggagcccgaa aagacatatg aggtggccgt gctcttctat gaccatgtgg atgcgattgg
      961 cgtgtatcga ctggaacaga caaccaaaga gagttggagc atcacctcca cccaactggt
     1021 gcgtgccgag gccggcaaat ggaatatatg caattttgca ttgaccgatg accggattta
     1081 tgtgactggt gcggagaatg accgtctaac gttgcgggtg tacgacagca ggaatggcga
     1141 gagggccact ggcctgccag acggttggct gaagatggtc ttagacaatc tagatgtggc
     1201 cgcattcatg cccgaggact tgtctgtttg gtttaagaaa cgattcgaca atgtcagcga
     1261 ttacttggag cgcaagaagc gtcgcatcga ggagcagaag cagcaaaaat gtggataatt
     1321 tacatacttc ttatctttac atagcattta attagtttat cggacaaaat taacggacta
     1381 tgtttgacaa atctgttaca tgaacatatt atattatatg cagatatata tatatatata
     1441 t