PREDICTED: Drosophila obscura proteasome subunit beta type-4-like

LOCUS       XM_022364257             696 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072410), mRNA.
ACCESSION   XM_022364257
VERSION     XM_022364257.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364257.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..696
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..696
                     /gene="LOC111072410"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins"
                     /db_xref="GeneID:111072410"
     CDS             1..696
                     /gene="LOC111072410"
                     /codon_start=1
                     /product="proteasome subunit beta type-4-like"
                     /protein_id="XP_022219949.2"
                     /db_xref="GeneID:111072410"
                     /translation="MNYHQYYQRASSERPELLKLIGTDKDEESIPWGSTVLGLRYDRG
                     VLIAAETCAHSEWMPRFQNMDRVFKISEQIIVGGGGDFGGIQKYKDTIDAQVIADRIY
                     WAAFEMKPKTEDHTAVLIVVGGMDPKTGPYLSSIDCRGRIVEDYVVTTGPALEAVLPM
                     VRNNKPKDREFSEQEALAMIWKGMTGALHCPDAREIPSYTVGICSANGCHIEGPYRAN
                     KDWTHARHNEVML"
     misc_feature    97..642
                     /gene="LOC111072410"
                     /note="The Ntn hydrolases (N-terminal nucleophile) are a
                     diverse superfamily of of enzymes that are activated
                     autocatalytically via an N-terminally lcated nucleophilic
                     amino acid. N-terminal nucleophile (NTN-) hydrolase
                     superfamily, which contains a...; Region: Ntn_hydrolase;
                     cl00467"
                     /db_xref="CDD:469781"
     misc_feature    order(100..102,148..150,154..156,196..198)
                     /gene="LOC111072410"
                     /note="active site"
                     /db_xref="CDD:238884"
ORIGIN      
        1 atgaactacc accaatacta ccagagggcc agctcggaaa ggcccgagct cctgaagtta
       61 attggcacgg acaaagacga agagtccatt ccctggggat ctaccgttct gggacttcgc
      121 tacgacaggg gggtcctgat tgcggccgaa acctgcgccc actctgaatg gatgcctcgg
      181 ttccagaata tggatcgggt gttcaaaata agcgaacaga ttattgtggg cggaggtggc
      241 gactttggtg gcatacaaaa atacaaggac acgattgatg cgcaggtcat cgcggatcgc
      301 atctactggg ccgccttcga gatgaagcca aagactgaag atcacacggc tgtgctgata
      361 gttgtgggtg gcatggatcc aaagacgggc ccctacctgt cctccatcga ttgtcgtggt
      421 cgcatcgtgg aggactacgt ggtgaccacg ggcccagccc tggaggcggt cctgcccatg
      481 gtgcgcaaca acaaaccgaa ggaccgagag ttttcggaac aggaggcgct cgctatgatc
      541 tggaagggca tgacgggggc attgcattgt cccgacgctc gtgaaattcc cagctacacg
      601 gtcggcatct gcagcgccaa cggatgccac attgagggac cctacagagc caacaaggac
      661 tggactcacg cccgtcacaa tgaagttatg ctctag