PREDICTED: Drosophila obscura cytochrome c oxidase subunit 6B1

LOCUS       XM_022364255             613 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072405), mRNA.
ACCESSION   XM_022364255
VERSION     XM_022364255.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364255.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..613
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..613
                     /gene="LOC111072405"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 6 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072405"
     CDS             116..349
                     /gene="LOC111072405"
                     /codon_start=1
                     /product="cytochrome c oxidase subunit 6B1"
                     /protein_id="XP_022219947.1"
                     /db_xref="GeneID:111072405"
                     /translation="MSALKLETAPFDPRFPNQNVTRYCYQSYIDFHRCQKKRGEDFAP
                     CNYFQKVYKSMCPNAWVEKWDDQRESGTFPGRI"
     misc_feature    122..343
                     /gene="LOC111072405"
                     /note="Cytochrome c oxidase subunit VIb. Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_VIb; cd00926"
                     /db_xref="CDD:238466"
     misc_feature    order(131..142,167..178,263..265,272..292)
                     /gene="LOC111072405"
                     /note="Subunit VIb/II interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    167..169
                     /gene="LOC111072405"
                     /note="Subunit VIb/I interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(179..181,188..190,335..337)
                     /gene="LOC111072405"
                     /note="Subunit VIb/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(227..229,233..250)
                     /gene="LOC111072405"
                     /note="Subunit VIb/VIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
     misc_feature    order(314..316,323..331)
                     /gene="LOC111072405"
                     /note="Subunit VIb/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238466"
ORIGIN      
        1 ggttttcgtt cgttttgcat cactatcgtc aggggttcgt gatacgctcg ccagttgaaa
       61 atttttcgtc taacattcgg aacaacaaag cgacaagtca ccagacagca gcaacatgtc
      121 ggccttaaag ctggagaccg ccccgtttga tccacgtttc ccgaaccaga acgtgactcg
      181 ttactgctac cagtcgtaca tcgacttcca tcgttgccag aagaagcgcg gcgaggactt
      241 tgcaccatgc aactatttcc aaaaggtgta caagtcgatg tgccccaatg cctgggtgga
      301 gaagtgggac gatcagcgtg agagcggcac attcccgggc cgcatctaag cccttccggt
      361 cctggcccca caatcccaga aaatagaagc agaagcagag taaaaacacc aacaccaaca
      421 cgacacgtaa aaacaacaac acaacccaac cagagctgag cagagggttg tctccaacat
      481 ccaagagcca ggatatctag caattgcagc agtaatgtca cactgtcacc aaactgtttc
      541 tgtttttagt tgccgacggt gaaaagcatt gacaaaatac aaataaacaa ttgttcaatt
      601 ctgtgaatac caa