PREDICTED: Drosophila obscura transmembrane protein 203

LOCUS       XM_022364254             525 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072404), mRNA.
ACCESSION   XM_022364254
VERSION     XM_022364254.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364254.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..525
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..525
                     /gene="LOC111072404"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111072404"
     CDS             1..438
                     /gene="LOC111072404"
                     /codon_start=1
                     /product="transmembrane protein 203"
                     /protein_id="XP_022219946.1"
                     /db_xref="GeneID:111072404"
                     /translation="MFKLSELVRWLGLTEFEILVNLCGLLVFTITLAFKISGTLNEVF
                     PELMKDWFTVFSPLFFIDICNAYFCVIVGIRMYLDSDNKRKALHRFMWSTYFLVLIAI
                     FKYLLCLKLSGRNTALEYSEVFSPIFVLLQLVAVRACQLPNSI"
     misc_feature    4..423
                     /gene="LOC111072404"
                     /note="Transmembrane protein 203; Region: TMEM203;
                     cd22816"
                     /db_xref="CDD:439364"
ORIGIN      
        1 atgttcaagc tatcggaact agtgcgctgg ctgggcctga ccgagttcga gatcctggtc
       61 aacctgtgcg gcctgctggt gttcaccata acgctagcct ttaagatatc cggcaccttg
      121 aatgaggttt tcccagagct gatgaaagac tggttcaccg tcttcagtcc cttgttcttc
      181 attgacatct gcaatgcgta cttctgcgtc attgtgggca tccgcatgta tctggactct
      241 gacaacaagc gcaaggcgct gcatcgcttc atgtggagca cctacttcct agtgctgatt
      301 gccatcttca agtatctgtt gtgtctcaag ctgtcgggca ggaatacggc gctggaatac
      361 agcgaggtct tctcgccgat attcgtcttg ctgcagttgg tggctgtccg ggcctgtcag
      421 ctgcccaatt ctatataatc tatagattta gcttagattc taaataaacc attgttaaaa
      481 tataaaattc aaaggaatct atcgtcagtg ttgggcaatt cgagt