PREDICTED: Drosophila obscura ribonuclease P protein subunit p20

LOCUS       XM_022364253             691 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072403), mRNA.
ACCESSION   XM_022364253
VERSION     XM_022364253.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364253.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..691
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..691
                     /gene="LOC111072403"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072403"
     CDS             98..691
                     /gene="LOC111072403"
                     /codon_start=1
                     /product="ribonuclease P protein subunit p20"
                     /protein_id="XP_022219945.1"
                     /db_xref="GeneID:111072403"
                     /translation="MMESNAPELRAKPRTTNNRNGHSRRNQSDSANNRVVRKLPPRAG
                     NDRCNIYITSKTDFKAQQKRCEELLNSGVKEIFLHCMGYSITRGLNLALRLIKNSEGA
                     LGYTINTSTIQLVDELHPLCDEDDITFRQRNNSALHIKIFSNNLFNIDVPQLPAQPAL
                     PKVSQREPSKPYQQQQQQQQPQKAKAKKQPPRSQKQE"
     misc_feature    245..517
                     /gene="LOC111072403"
                     /note="Rpp20 subunit of nuclear RNase MRP and P; Region:
                     Rpp20; pfam12328"
                     /db_xref="CDD:372048"
ORIGIN      
        1 tgttgattaa tgcgcaacac tcgtctgtct cgtctctgtc cgaatactgg taaaaacacc
       61 gtaccacaaa gaaagtaatg ggtgttaatc tactctgatg atggaaagta atgcgcctga
      121 gctcagggcc aagccaagaa caacaaacaa tagaaacggc cactctaggc gaaaccaaag
      181 cgacagtgcc aataacagag tggttcgcaa gctaccgcct cgtgctggca acgaccgctg
      241 caacatctac attaccagca aaacagactt caaggcccag cagaagcgat gcgaggaact
      301 gctcaattcg ggcgttaagg agatattctt gcattgcatg ggctactcga tcactcgcgg
      361 cctcaaccta gccctgcgtc ttatcaagaa ctcggagggc gccttgggct acaccatcaa
      421 cacctccacc atacagctgg tggacgagct gcatccgctc tgtgatgagg acgacataac
      481 ctttcggcag cgaaacaact cggcactgca catcaagatc ttcagcaaca acctattcaa
      541 tattgatgtg ccccagcttc cggctcagcc tgctctacca aaggtcagcc aacgcgagcc
      601 gtcaaagccc taccagcagc agcagcagca gcaacaacca cagaaggcga aggccaagaa
      661 gcagccgccc aggtcacaaa agcaagaata a