Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022364244 1917 bp mRNA linear INV 14-MAY-2021 (LOC111072398), mRNA. ACCESSION XM_022364244 VERSION XM_022364244.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022364244.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1917 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1917 /gene="LOC111072398" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111072398" CDS 141..1598 /gene="LOC111072398" /codon_start=1 /product="Golgi resident protein GCP60" /protein_id="XP_022219936.1" /db_xref="GeneID:111072398" /translation="METATSSSDTPTATAAPPVPAAEKWGFPLQELYRLAFTFYKQNS GKAIHLSYEDNLKLIAFKQQASLGPFKTNDAPALGVLDVIGRDRQQHWQLLGDISREQ AMEGFIDLLDTMCSAFRPYIEAVRQDRDETLRKDLRRMELEKEVAQKRERQQQELLEE GYKEELQRRQLQDALNKQTYQQFKLYAEKQFPGNPEQQAVLIHQLQREHYHQYMQQLH LQNQNQNQTQTQEKAHQEKEEMAPANNNNSSTDLANAMEGLKLGDFEQQTEEQHQHQH EQQHVEQAQTQAGGEYGQEQHNHVNDEYDDYVMIRPAKIWTRPDIEQFKTEVSAGDGD GVITIGHGDTVTVRVPTNMNGKCIFWEFATDSYDIGFGIYFEWAKPVTNEVTVHVSDS DEEEDCVDEDYLSTTEDLESGTLSQDQNGLNNPIAASKAPISIIVPIYRRECYNEVYV GSHSYPGEGVYLLKFDNSYSIWRSKTLYYRVYYER" misc_feature 228..473 /gene="LOC111072398" /note="Acyl CoA binding protein; Region: ACBP; pfam00887" /db_xref="CDD:459982" misc_feature <462..>764 /gene="LOC111072398" /note="ATP-dependent Clp protease, ATP-binding subunit ClpA [Posttranslational modification, protein turnover, chaperones]; Region: ClpA; COG0542" /db_xref="CDD:440308" misc_feature 1155..1589 /gene="LOC111072398" /note="GPCR-chaperone; Region: GPCR_chapero_1; cl46312" /db_xref="CDD:480652" ORIGIN 1 aaaacactga tattttgtgg cacgacggtc acacttgaag aaaacgtcac atacgaatta 61 tatttttttg ttttgattgt gcgaattttt tatagaggca aacagacttt ggaaacatcg 121 ggaaaacact ggcggcaaat atggagaccg cgacaagcag cagcgacaca ccaacagcga 181 cagccgcacc cccagtccca gctgcagaga aatggggatt tccgctgcaa gaactctacc 241 gactagcatt cacattctac aaacagaact cgggcaaagc catacacctg tcctacgagg 301 acaatctgaa gctaatcgcc ttcaagcagc aggcatctct cggacccttc aaaacgaacg 361 atgccccagc tttgggcgtg ctcgatgtaa ttggccgcga ccgccagcag cactggcagc 421 ttctgggcga cataagccgg gagcaggcca tggaggggtt cattgatcta ctggacacga 481 tgtgcagtgc atttcgaccc tatatcgagg cggtgcgtca ggaccgcgat gagacattgc 541 gaaaagactt gcgacgcatg gaactggaga aggaggtggc acagaaacgg gagcgccagc 601 agcaggagct gctggaggag ggttacaaag aggagctgca acgacgtcag ctgcaggacg 661 ctctcaacaa gcagacatac cagcagttca agctgtatgc cgagaaacag tttccgggaa 721 atccagagca gcaggctgta ctcatacacc agctgcagcg cgagcactac catcagtata 781 tgcagcagtt gcatttgcaa aatcagaacc agaaccagac acagacccag gaaaaggcac 841 atcaggaaaa ggaggaaatg gctccggcca acaacaataa tagcagcacc gatctagcga 901 atgccatgga gggcttaaaa ctgggtgatt ttgagcagca gacagaggag cagcaccagc 961 accagcacga gcagcagcac gtcgagcagg cacagacaca ggcaggcgga gagtacggac 1021 aggagcagca caaccatgtg aacgatgagt acgatgatta tgtgatgatt cgcccggcca 1081 aaatctggac gcgacccgac atcgagcagt tcaagactga agtgtccgca ggcgatggcg 1141 atggcgtcat taccatcgga catggcgaca cggtgacggt tcgtgtgccc accaatatga 1201 acgggaagtg catcttttgg gaatttgcca cagacagcta cgacattggt ttcggcattt 1261 acttcgagtg ggccaagccg gtgaccaacg aggtgacggt acacgtgagc gacagcgatg 1321 aggaagagga ttgtgtggac gaagattatc tgtccaccac tgaggacctg gagtcgggca 1381 cattgtcgca ggatcagaat ggcctgaaca atccgattgc tgcctcaaag gcgcccatct 1441 caattattgt gccaatctat cggcgcgagt gctacaacga ggtctatgtc ggttcccact 1501 cctatcccgg cgagggcgtc tacttgctga agttcgacaa cagctacagc atctggcgct 1561 ccaaaaccct gtactatcgc gtctattacg agcgctaaga ggccaaatca gaatacccca 1621 tacccccagt tacttaagcg aaatctattt tatctacata tacatatgta ctatctaaat 1681 attcagtgtg caagcagccg ccattgcaag gctctttgtg caagtccaaa acattacgat 1741 gtctgtgtgg gtgttggtgt tggtgtatgt atatgtatgt atatctatcc atctccaaaa 1801 atcaaaacaa aacaaaaata catattagtt cccagtcgcg gccctggaga tggatgcatt 1861 caaatcaatt ataatttatt atttagtttt taataataaa aagaatgaaa agacgta