Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura Golgi resident protein GCP60


LOCUS       XM_022364244            1917 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111072398), mRNA.
ACCESSION   XM_022364244
VERSION     XM_022364244.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022364244.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1917
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1917
                     /gene="LOC111072398"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111072398"
     CDS             141..1598
                     /gene="LOC111072398"
                     /codon_start=1
                     /product="Golgi resident protein GCP60"
                     /protein_id="XP_022219936.1"
                     /db_xref="GeneID:111072398"
                     /translation="METATSSSDTPTATAAPPVPAAEKWGFPLQELYRLAFTFYKQNS
                     GKAIHLSYEDNLKLIAFKQQASLGPFKTNDAPALGVLDVIGRDRQQHWQLLGDISREQ
                     AMEGFIDLLDTMCSAFRPYIEAVRQDRDETLRKDLRRMELEKEVAQKRERQQQELLEE
                     GYKEELQRRQLQDALNKQTYQQFKLYAEKQFPGNPEQQAVLIHQLQREHYHQYMQQLH
                     LQNQNQNQTQTQEKAHQEKEEMAPANNNNSSTDLANAMEGLKLGDFEQQTEEQHQHQH
                     EQQHVEQAQTQAGGEYGQEQHNHVNDEYDDYVMIRPAKIWTRPDIEQFKTEVSAGDGD
                     GVITIGHGDTVTVRVPTNMNGKCIFWEFATDSYDIGFGIYFEWAKPVTNEVTVHVSDS
                     DEEEDCVDEDYLSTTEDLESGTLSQDQNGLNNPIAASKAPISIIVPIYRRECYNEVYV
                     GSHSYPGEGVYLLKFDNSYSIWRSKTLYYRVYYER"
     misc_feature    228..473
                     /gene="LOC111072398"
                     /note="Acyl CoA binding protein; Region: ACBP; pfam00887"
                     /db_xref="CDD:459982"
     misc_feature    <462..>764
                     /gene="LOC111072398"
                     /note="ATP-dependent Clp protease, ATP-binding subunit
                     ClpA [Posttranslational modification, protein turnover,
                     chaperones]; Region: ClpA; COG0542"
                     /db_xref="CDD:440308"
     misc_feature    1155..1589
                     /gene="LOC111072398"
                     /note="GPCR-chaperone; Region: GPCR_chapero_1; cl46312"
                     /db_xref="CDD:480652"
ORIGIN      
        1 aaaacactga tattttgtgg cacgacggtc acacttgaag aaaacgtcac atacgaatta
       61 tatttttttg ttttgattgt gcgaattttt tatagaggca aacagacttt ggaaacatcg
      121 ggaaaacact ggcggcaaat atggagaccg cgacaagcag cagcgacaca ccaacagcga
      181 cagccgcacc cccagtccca gctgcagaga aatggggatt tccgctgcaa gaactctacc
      241 gactagcatt cacattctac aaacagaact cgggcaaagc catacacctg tcctacgagg
      301 acaatctgaa gctaatcgcc ttcaagcagc aggcatctct cggacccttc aaaacgaacg
      361 atgccccagc tttgggcgtg ctcgatgtaa ttggccgcga ccgccagcag cactggcagc
      421 ttctgggcga cataagccgg gagcaggcca tggaggggtt cattgatcta ctggacacga
      481 tgtgcagtgc atttcgaccc tatatcgagg cggtgcgtca ggaccgcgat gagacattgc
      541 gaaaagactt gcgacgcatg gaactggaga aggaggtggc acagaaacgg gagcgccagc
      601 agcaggagct gctggaggag ggttacaaag aggagctgca acgacgtcag ctgcaggacg
      661 ctctcaacaa gcagacatac cagcagttca agctgtatgc cgagaaacag tttccgggaa
      721 atccagagca gcaggctgta ctcatacacc agctgcagcg cgagcactac catcagtata
      781 tgcagcagtt gcatttgcaa aatcagaacc agaaccagac acagacccag gaaaaggcac
      841 atcaggaaaa ggaggaaatg gctccggcca acaacaataa tagcagcacc gatctagcga
      901 atgccatgga gggcttaaaa ctgggtgatt ttgagcagca gacagaggag cagcaccagc
      961 accagcacga gcagcagcac gtcgagcagg cacagacaca ggcaggcgga gagtacggac
     1021 aggagcagca caaccatgtg aacgatgagt acgatgatta tgtgatgatt cgcccggcca
     1081 aaatctggac gcgacccgac atcgagcagt tcaagactga agtgtccgca ggcgatggcg
     1141 atggcgtcat taccatcgga catggcgaca cggtgacggt tcgtgtgccc accaatatga
     1201 acgggaagtg catcttttgg gaatttgcca cagacagcta cgacattggt ttcggcattt
     1261 acttcgagtg ggccaagccg gtgaccaacg aggtgacggt acacgtgagc gacagcgatg
     1321 aggaagagga ttgtgtggac gaagattatc tgtccaccac tgaggacctg gagtcgggca
     1381 cattgtcgca ggatcagaat ggcctgaaca atccgattgc tgcctcaaag gcgcccatct
     1441 caattattgt gccaatctat cggcgcgagt gctacaacga ggtctatgtc ggttcccact
     1501 cctatcccgg cgagggcgtc tacttgctga agttcgacaa cagctacagc atctggcgct
     1561 ccaaaaccct gtactatcgc gtctattacg agcgctaaga ggccaaatca gaatacccca
     1621 tacccccagt tacttaagcg aaatctattt tatctacata tacatatgta ctatctaaat
     1681 attcagtgtg caagcagccg ccattgcaag gctctttgtg caagtccaaa acattacgat
     1741 gtctgtgtgg gtgttggtgt tggtgtatgt atatgtatgt atatctatcc atctccaaaa
     1801 atcaaaacaa aacaaaaata catattagtt cccagtcgcg gccctggaga tggatgcatt
     1861 caaatcaatt ataatttatt atttagtttt taataataaa aagaatgaaa agacgta