PREDICTED: Drosophila obscura uncharacterized LOC111070736

LOCUS       XM_022361478             963 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070736), mRNA.
ACCESSION   XM_022361478
VERSION     XM_022361478.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361478.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..963
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..963
                     /gene="LOC111070736"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111070736"
     CDS             49..609
                     /gene="LOC111070736"
                     /codon_start=1
                     /product="uncharacterized protein LOC111070736"
                     /protein_id="XP_022217170.2"
                     /db_xref="GeneID:111070736"
                     /translation="MEVFIENRQRNAINATIFIDRVQVVVRNLLIYLWTYIFLKLLRF
                     RVWVQLRLCMRYFRRLTAKLSYYHHRNRELPLKYIEQLDKINDIMAMLMLKDMDIDDL
                     GRFPRLDVPLHIYQDYLLIKQEVMEIEMKLLKVYVERLREGPEEEEFEWQEEIDSGSG
                     SDSDSDDYSDNTDSDFFDFTDDDMDR"
ORIGIN      
        1 tgcgcaaaat atacgtatag aaaatattcg tggaaaagta attggaaaat ggaagttttt
       61 attgaaaatc gtcagcgcaa tgcaatcaac gctactattt ttattgatcg cgtacaggtg
      121 gtagtgcgta atttgctaat ctacttgtgg acctacatat tcctgaagct actccgcttc
      181 cgggtgtggg ttcaacttcg gctctgcatg cggtacttcc gtagactgac tgccaagctt
      241 agctattacc atcatcgcaa tcgtgaactt cccttgaaat acattgagca attggacaaa
      301 ataaatgaca taatggctat gctgatgctc aaagatatgg acattgatga cttgggacgc
      361 tttccacgac tggatgtacc cttacatatc taccaggatt atctgttaat caagcaggag
      421 gtgatggaga ttgagatgaa gttgctcaaa gtatacgttg aaagacttcg ggaagggcct
      481 gaagaagaag aatttgaatg gcaagaggag atcgacagcg gcagcggcag cgacagcgac
      541 agcgacgatt actcggacaa taccgattcc gatttctttg atttcactga cgatgatatg
      601 gatagataga tagttaaatg ggctgctgct ccgaaaaaag aaaacaaaat aagacaactg
      661 ctatgacccc tcccactccg cccaaccaac cacactctgc tacttttggc tgttgcaaat
      721 acgaaataga tgacaaacaa aaacaatacg cccgagtaga ttccagaaca ttggccacac
      781 atttaagaat caattcagcc agacagtcaa ttgttgtctt tgtttggctg ttcggctgtt
      841 tggctgaact atgtaaatca aaatttaaag tgtttactgc ctgattgcca gagttagata
      901 atggactcgg ccatgcagta attgcaatat aaattgcatt gttctctgtt gcaataaaac
      961 aca