Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura protein germ cell-less-like


LOCUS       XM_022361473            1399 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070731), mRNA.
ACCESSION   XM_022361473
VERSION     XM_022361473.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361473.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1399
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1399
                     /gene="LOC111070731"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070731"
     CDS             189..1274
                     /gene="LOC111070731"
                     /codon_start=1
                     /product="protein germ cell-less-like"
                     /protein_id="XP_022217165.2"
                     /db_xref="GeneID:111070731"
                     /translation="MPNSNASDALQWYRQPRDGLHLSNLCEKSLGKSVSHLTATHYYH
                     VACENEMQNLRKIVVDWFLVNLMDPSVGQPHLLRRIPIELMTELVASPNLYVVPGEKE
                     LYELLCMWMYLRIHLGSEPGDLENQGKARQTLRKLEAAQMTPLRYFAERYGPRGSFLE
                     TAAGQPYVKVFQKLRTQYLCISDSSVKELDDGRVLPAKWVGGHLLNSWLDSVLYFDVD
                     AEYLPHGMVTSEFFLKRCNRLGIVLTKPSKEWWRWPNVAIGMDICGTMQDYKLKIRFE
                     YDLKLSGLLKYYQRQQILVRGLVVALKEGLQLGHSAKSPIIPLDASLESGMPVTILEV
                     NGWLPYPLKVSLNILIGVPLHESFKVA"
     misc_feature    288..527
                     /gene="LOC111070731"
                     /note="BACK (BTB and C-terminal Kelch) domain; Region:
                     BACK; cl28903"
                     /db_xref="CDD:475122"
ORIGIN      
        1 cccgtttcag tgtggccaaa gttcgtgcag ccaagccacg cgaaaatagt gtaaatcgga
       61 aaataaaaga gtcacgtttg gtgtttttgc tgcatattct gtgtgaatcg gattggggct
      121 tggctttctt gaggattttc caagttccaa gctgtctgtg aatatcttct gcgaacacgt
      181 gcttcaatat gcccaacagt aatgcaagtg atgccttgca gtggtaccgg cagcccaggg
      241 atggactgca cctgagcaat ctctgcgaga aaagcctggg gaagagcgta agtcacttga
      301 cggccacgca ctactaccac gtggcctgcg agaatgagat gcagaacctg cggaagatcg
      361 tggtggactg gtttctcgtc aacctcatgg acccctccgt cggccagccc cacctgctgc
      421 gacgcatccc catagagctg atgactgagc tcgtggccag ccccaacctg tacgtggtgc
      481 ccggcgagaa ggagttgtac gaactgctgt gcatgtggat gtatctgcgc attcacctcg
      541 gctccgagcc cggggatctg gagaaccagg gaaaggcccg ccagacgctg cgcaagctgg
      601 aagcggctca aatgactccg ttgcggtact ttgccgaacg ctacggccct cgtggctcct
      661 ttcttgaaac tgccgccgga cagccctacg tgaaggtgtt ccagaagctg cggactcagt
      721 atctctgcat aagcgacagc agtgtgaagg agctggacga cgggagggtg ctcccggcga
      781 aatgggtagg aggccatttg ctgaactcct ggttggacag cgtcctgtat ttcgatgtcg
      841 atgccgagta tctgccgcat ggcatggtta ccagcgagtt cttcctgaag cggtgcaacc
      901 gactcggcat agttctgacc aagccgtcta aggaatggtg gcgctggccg aatgttgcca
      961 ttggcatgga catttgcgga acaatgcagg attacaagct gaagattcgc ttcgaatatg
     1021 acttgaaact ctcaggactt ctgaaatact accagaggca acagatccta gtccgcggcc
     1081 tcgtagtcgc cctaaaggaa ggactgcagc tgggacacag cgcaaagtcg ccaattattc
     1141 cgctggacgc gagcttggag agcggaatgc cggtaacaat cttggaggtg aatggctggc
     1201 tgccgtatcc cctcaaagtt tcgctcaaca ttttgattgg tgtgcccctc cacgagagct
     1261 tcaaggttgc ctgagtgctg cacgctgatg ctcctgtaga gctgagatgc gatccaccga
     1321 cctgttctta aattctatcc ataatccaat atatatattt gtctattcac aataaacccc
     1381 atctgctctg ccaggtccc