Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura spore coat protein SP96


LOCUS       XM_022361469            1258 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070728), mRNA.
ACCESSION   XM_022361469
VERSION     XM_022361469.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361469.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1258
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1258
                     /gene="LOC111070728"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 1 sample with support for all annotated introns"
                     /db_xref="GeneID:111070728"
     CDS             9..1109
                     /gene="LOC111070728"
                     /codon_start=1
                     /product="spore coat protein SP96"
                     /protein_id="XP_022217161.2"
                     /db_xref="GeneID:111070728"
                     /translation="MFHSKLLHRLHLLLSVASVLAQYDLYGDLSYGGSAESQLDYLFT
                     DSDYDVICPPGGSPVCATDGSQYQRFGSKCRLDSHNLKLLFAGSPELTQTDLIYCSSY
                     SALAPSPYYLRAPAQPSGYPAVSGSSSFAYATAHGPYGAKASAEAPGPYAVGSASYPS
                     YPKSAPAYRPYGGAYPTVTAAPASVSTTTKAAPRYPPRYPPRYPPRYPTVATTSTSAP
                     TSTSAPTAAPTATTTEASTAAPTTAAPTEVTTTAASTSASTDASTAASTEVTSTAAST
                     SASTAASTAASTSTSTDASTDASTDASTAASTTAAPSGDLVITETSGTVTTTTTVTPG
                     TIETCPDTFTSFTVLLNGVTSTVSGCKTVTTT"
ORIGIN      
        1 gccacagcat gttccactcc aagctgctcc atcggctcca tctgctcctc agcgtggcca
       61 gtgtcctggc tcagtatgat ctctatggag acttgtcgta cggcggctcg gcggagtcgc
      121 agctggatta cttgttcacg gacagcgact acgacgtcat ttgtccgccc ggcggcagcc
      181 cggtgtgcgc cacggacggc agccagtacc agcggttcgg cagcaagtgc cgcctggact
      241 cgcacaacct caagctgctg ttcgccggca gtccggaact gacgcaaacg gatctcatct
      301 actgctcctc gtactcggct ctggccccgt ccccctatta tctgcgcgcc ccagcgcagc
      361 cttcgggcta ccctgcggtc tcgggctcca gctcgttcgc ttatgccacg gcccatgggc
      421 cctatggcgc caaggcatcc gctgaggctc caggtcccta tgccgtggga tccgcctcct
      481 atccctcgta tccgaaaagc gctccggcgt acaggcctta cggcggagcg tatcccacag
      541 ttactgcggc tccggctagt gtttccacaa cgaccaaggc agctcctagg taccctccta
      601 ggtatccccc caggtatccg cccaggtatc ccactgttgc cacaacttca acgtctgccc
      661 ccacatccac atctgcaccc acggcggcac ctactgctac aaccactgag gcatccaccg
      721 ctgctccaac aacagctgca cccactgagg taacaacaac cgccgcttca acctctgcct
      781 ccacggatgc ttctacggct gcatccactg aggtaacaag caccgcagct tcaacctctg
      841 cctccacggc tgcttctacg gctgcttcaa cctctacctc cacggatgcc tcaacggatg
      901 cttctacgga tgcttctacg gctgcttcca caaccgctgc tccctccggc gatctggtga
      961 tcacggagac aagcggcacg gttaccacca ccaccaccgt gacgccgggc acgatcgaaa
     1021 cctgtcccga cacctttacc agcttcaccg tcctcttgaa tggagtgacg agcaccgtca
     1081 gtggctgcaa gactgtcaca acaacctgag gagtggcgaa tccagcggga agttgagaaa
     1141 ccagcagcac cgttgagcgg tcatagattc aatataattc aaaatagttc aaatcgatcc
     1201 gatccgatcc actgcaatgt gcagagtgtt ccatttaatg taataaaact gtcagtac