Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361469 1258 bp mRNA linear INV 14-MAY-2021 (LOC111070728), mRNA. ACCESSION XM_022361469 VERSION XM_022361469.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361469.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1258 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1258 /gene="LOC111070728" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns" /db_xref="GeneID:111070728" CDS 9..1109 /gene="LOC111070728" /codon_start=1 /product="spore coat protein SP96" /protein_id="XP_022217161.2" /db_xref="GeneID:111070728" /translation="MFHSKLLHRLHLLLSVASVLAQYDLYGDLSYGGSAESQLDYLFT DSDYDVICPPGGSPVCATDGSQYQRFGSKCRLDSHNLKLLFAGSPELTQTDLIYCSSY SALAPSPYYLRAPAQPSGYPAVSGSSSFAYATAHGPYGAKASAEAPGPYAVGSASYPS YPKSAPAYRPYGGAYPTVTAAPASVSTTTKAAPRYPPRYPPRYPPRYPTVATTSTSAP TSTSAPTAAPTATTTEASTAAPTTAAPTEVTTTAASTSASTDASTAASTEVTSTAAST SASTAASTAASTSTSTDASTDASTDASTAASTTAAPSGDLVITETSGTVTTTTTVTPG TIETCPDTFTSFTVLLNGVTSTVSGCKTVTTT" ORIGIN 1 gccacagcat gttccactcc aagctgctcc atcggctcca tctgctcctc agcgtggcca 61 gtgtcctggc tcagtatgat ctctatggag acttgtcgta cggcggctcg gcggagtcgc 121 agctggatta cttgttcacg gacagcgact acgacgtcat ttgtccgccc ggcggcagcc 181 cggtgtgcgc cacggacggc agccagtacc agcggttcgg cagcaagtgc cgcctggact 241 cgcacaacct caagctgctg ttcgccggca gtccggaact gacgcaaacg gatctcatct 301 actgctcctc gtactcggct ctggccccgt ccccctatta tctgcgcgcc ccagcgcagc 361 cttcgggcta ccctgcggtc tcgggctcca gctcgttcgc ttatgccacg gcccatgggc 421 cctatggcgc caaggcatcc gctgaggctc caggtcccta tgccgtggga tccgcctcct 481 atccctcgta tccgaaaagc gctccggcgt acaggcctta cggcggagcg tatcccacag 541 ttactgcggc tccggctagt gtttccacaa cgaccaaggc agctcctagg taccctccta 601 ggtatccccc caggtatccg cccaggtatc ccactgttgc cacaacttca acgtctgccc 661 ccacatccac atctgcaccc acggcggcac ctactgctac aaccactgag gcatccaccg 721 ctgctccaac aacagctgca cccactgagg taacaacaac cgccgcttca acctctgcct 781 ccacggatgc ttctacggct gcatccactg aggtaacaag caccgcagct tcaacctctg 841 cctccacggc tgcttctacg gctgcttcaa cctctacctc cacggatgcc tcaacggatg 901 cttctacgga tgcttctacg gctgcttcca caaccgctgc tccctccggc gatctggtga 961 tcacggagac aagcggcacg gttaccacca ccaccaccgt gacgccgggc acgatcgaaa 1021 cctgtcccga cacctttacc agcttcaccg tcctcttgaa tggagtgacg agcaccgtca 1081 gtggctgcaa gactgtcaca acaacctgag gagtggcgaa tccagcggga agttgagaaa 1141 ccagcagcac cgttgagcgg tcatagattc aatataattc aaaatagttc aaatcgatcc 1201 gatccgatcc actgcaatgt gcagagtgtt ccatttaatg taataaaact gtcagtac