Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361456 803 bp mRNA linear INV 14-MAY-2021 (LOC111070720), mRNA. ACCESSION XM_022361456 VERSION XM_022361456.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361456.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..803 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..803 /gene="LOC111070720" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns" /db_xref="GeneID:111070720" CDS 69..719 /gene="LOC111070720" /codon_start=1 /product="uncharacterized protein LOC111070720" /protein_id="XP_022217148.2" /db_xref="GeneID:111070720" /translation="MNIPGIISLPNQRIPKHNIMQAGVFAFLLMLLLGGARAIASASD STHCRCLAAVHLDMCHIEDLFFCDTNHAEDLQAANDEVIDSQKVWPLTWRRRSHLSHR AKLLRDLKWELHVYKSNIMAEQQLIEKVVELAYVVHYNHVRQQNILSEVADQLLEMRA VDAIRFVNYISSDLREQISSPTDKWRSPYFDIIERDYLEVPSEREGRPFLQQYRHH" ORIGIN 1 gtatgttttg aggcgctact caacactgct taaatatcat tccagcatca catggaatgt 61 aatcatccat gaacatccca ggcataattt ccctacccaa ccagaggatt cccaaacata 121 acataatgca ggccggcgtc tttgcttttc ttttgatgct tcttcttggc ggagccagag 181 ccatagcttc tgcctccgac agcacccact gtcggtgctt ggcagctgtg catttggata 241 tgtgtcatat cgaggacttg tttttttgtg ataccaatca cgcagaagat cttcaagcag 301 caaacgatga agtgatagac tcacagaaag tgtggcccct cacatggcgc aggcgcagcc 361 atctgagtca tcgggccaaa ctgttgaggg acctcaaatg ggagcttcac gtctacaaaa 421 gcaacattat ggctgaacag cagttgatcg agaaggtagt cgagctggct tacgtcgtac 481 actacaacca tgtacgtcaa caaaatatcc tatcggaagt ggctgaccag ctgttggaaa 541 tgcgcgctgt tgacgccatt cgatttgtca actacatatc ctcggatctc cgcgaacaga 601 tctcatctcc caccgacaaa tggcgttccc cgtattttga tattatagag cgtgactacc 661 ttgaggtgcc aagtgaaaga gaaggaagac cctttctcca acagtacaga catcactaaa 721 gaaaatactt ccgaaaaagc cgaacaattc atactaatta acttataagc gagcagaaaa 781 acagaaccca aagaaataaa tga