Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura proteasome subunit beta type-3-like


LOCUS       XM_022361452             653 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070718), mRNA.
ACCESSION   XM_022361452
VERSION     XM_022361452.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361452.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 6% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..653
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..653
                     /gene="LOC111070718"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 94% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111070718"
     CDS             78..653
                     /gene="LOC111070718"
                     /codon_start=1
                     /product="proteasome subunit beta type-3-like"
                     /protein_id="XP_022217144.2"
                     /db_xref="GeneID:111070718"
                     /translation="MSAIISGSAVALSGKHCVAIATDHPIAGSNFDHGNMFKVAPLIY
                     VALSGPQQDVVRVRDRMKLRQNMFGMVTPEIYAKNLSNYLSEPRLQPYHVESVVAGLH
                     SETVLPFICSLNESGLLLDADDFTTGGKCPGIGAICKSLWKPNMGPADLVAVLSDAIL
                     NGSNLIGTRSWGVTIYVLHKLSEHVILMPKN"
     misc_feature    96..617
                     /gene="LOC111070718"
                     /note="The Ntn hydrolases (N-terminal nucleophile) are a
                     diverse superfamily of of enzymes that are activated
                     autocatalytically via an N-terminally lcated nucleophilic
                     amino acid. N-terminal nucleophile (NTN-) hydrolase
                     superfamily, which contains a...; Region: Ntn_hydrolase;
                     cl00467"
                     /db_xref="CDD:469781"
     misc_feature    order(96..98,144..146,150..152,180..182)
                     /gene="LOC111070718"
                     /note="active site"
                     /db_xref="CDD:238884"
ORIGIN      
        1 catcagtcac tgcggcccct acccagaagt attttgtgag aaaataagca aatttgaatt
       61 aaaaactaat aagaaatatg tctgcgatta tcagtggcag tgctgtggcc ctaagcggca
      121 agcattgcgt ggccattgcc acggatcatc ccattgctgg cagcaacttt gaccatggca
      181 atatgtttaa agtggcgccc ctgatctatg tggcgctctc aggaccccaa caagatgtgg
      241 tcagagtgcg cgatcgcatg aagttgcgcc agaatatgtt tggcatggtg acgcccgaga
      301 tatatgcaaa aaatctgtcc aactatctga gtgaaccccg tctgcagccc taccatgtcg
      361 agagcgttgt cgctggcctc cacagcgaga ccgtgctgcc attcatttgc agtttgaatg
      421 agagcggact attgctggat gccgatgact tcaccacggg cggcaagtgc ccgggcattg
      481 gggccatttg caagagtctc tggaagccga atatggggcc agccgatctc gtagcggtgc
      541 tatccgacgc cattttgaat ggctccaatc tcattggcac acgcagctgg ggtgtcacca
      601 tttacgttct gcacaagctg tccgaacacg ttattctgat gcccaagaac tag