PREDICTED: Drosophila obscura uncharacterized LOC111070717

LOCUS       XM_022361451             644 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070717), mRNA.
ACCESSION   XM_022361451
VERSION     XM_022361451.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361451.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..644
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..644
                     /gene="LOC111070717"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 6 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070717"
     CDS             95..562
                     /gene="LOC111070717"
                     /codon_start=1
                     /product="uncharacterized protein LOC111070717"
                     /protein_id="XP_022217143.2"
                     /db_xref="GeneID:111070717"
                     /translation="MPPKGRPSGHKRGKGQLKGMESPDGLSADGSALDLGKIPVILED
                     PSIFTIGIIADTEVTLGFLLAGIGFRRDNLNNYLMVHDDTSQEEIENFFEHLYKMHNL
                     GIIILDFQTNKRLKLVLEKCKNMLPVVVVVPNKASLVPYQEWKGRKHIHEQDL"
     misc_feature    242..529
                     /gene="LOC111070717"
                     /note="ATP synthase (F/14-kDa) subunit; Region:
                     ATP-synt_F; pfam01990"
                     /db_xref="CDD:460409"
ORIGIN      
        1 tcaatcaaaa acgttgacga tagctctgag agttttcaat tttgtctggt tatagacagg
       61 agaaacagga agagagagag agaaacagag aaagatgcca ccaaagggac gaccgtcggg
      121 ccataaaagg ggcaagggcc agctgaaggg tatggaaagc ccggatggtc tttcggccga
      181 cggaagtgcg cttgacctgg gcaaaattcc agtgatcctt gaggatccga gcatttttac
      241 cattgggatc attgcagata ccgaggtaac cttggggttt ctgctggctg gcattggctt
      301 ccgtcgggac aatcttaaca attacctgat ggtgcacgac gacacgtccc aggaggagat
      361 cgagaacttc ttcgagcatc tgtacaagat gcacaacctt gggatcatca tactcgactt
      421 tcaaacgaac aagcggctca aactagtgtt ggaaaagtgc aaaaatatgc tgcccgtggt
      481 agtcgtggta ccgaacaagg ccagcctggt gccctatcag gaatggaagg gtcgcaagca
      541 catccacgaa caggatctct aagcgagcgg agctctccat tccgctcttt ctctttatct
      601 cttacttgaa cggaaattgg gttaaagcat aaattttaaa gtaa