Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura proteasome subunit beta type-3-like


LOCUS       XM_022361448             752 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070714), transcript variant X2, mRNA.
ACCESSION   XM_022361448
VERSION     XM_022361448.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361448.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..752
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..752
                     /gene="LOC111070714"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111070714"
     CDS             252..653
                     /gene="LOC111070714"
                     /codon_start=1
                     /product="proteasome subunit beta type-3-like isoform X2"
                     /protein_id="XP_022217140.2"
                     /db_xref="GeneID:111070714"
                     /translation="MNIRQKLRLQVITPDIYIKNLSNILYEQRPKPYQVDCIVLGLQP
                     GTMRPFISTLDMLGVPNELDDFVAIGKRSPQLHATCEALWKPKMEPADLLQTISSSIL
                     ADTDPKVTIGALVYVVERGRITESTVEIEED"
     misc_feature    <285..635
                     /gene="LOC111070714"
                     /note="The Ntn hydrolases (N-terminal nucleophile) are a
                     diverse superfamily of of enzymes that are activated
                     autocatalytically via an N-terminally lcated nucleophilic
                     amino acid. N-terminal nucleophile (NTN-) hydrolase
                     superfamily, which contains a...; Region: Ntn_hydrolase;
                     cl00467"
                     /db_xref="CDD:469781"
ORIGIN      
        1 taaaaatggc cacacttctg ataaatttaa aacattgtag ccgcagaaac taaacaacta
       61 aagaaagaaa gaaatcatag caatatgatt taaagtatca atcaaatgtc ttcaactgca
      121 agcaacacgg cacatagtgt tggaggtagc atggtggcca tgcaaggcat ggactgtgtg
      181 gccattgcta cggatcatgc ggctgacaat aatttgttca gaggcccaag aatgatatta
      241 tagccgtgtg catgaacatc cgccagaagt tgcgattaca ggtgataacg ccagacatat
      301 atatcaagaa tctgtccaac atattgtacg aacaacgccc gaaaccctat caagtggact
      361 gcattgtgct tggcctccag cccggtacaa tgaggccgtt catttccacg ctggatatgc
      421 ttggagtccc aaatgaactg gacgacttcg ttgcaattgg aaagcgcagc ccgcagcttc
      481 atgctacgtg cgaggctctg tggaaaccaa agatggaacc tgcggatctg ttgcagacta
      541 tttcgtcatc cattttggcg gataccgacc ccaaagtaac cattggtgcc cttgtctatg
      601 ttgttgaaag aggcaggata acagagtcca cagtggagat tgaagaggac taggcaactt
      661 aatataattc tgtgtgacat attgtttagg aaatcaaaaa aaaaaatcac gcaaaataaa
      721 atgcgctcaa actgcacaca aacacacaca ca