Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361448 752 bp mRNA linear INV 14-MAY-2021 (LOC111070714), transcript variant X2, mRNA. ACCESSION XM_022361448 VERSION XM_022361448.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361448.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..752 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..752 /gene="LOC111070714" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:111070714" CDS 252..653 /gene="LOC111070714" /codon_start=1 /product="proteasome subunit beta type-3-like isoform X2" /protein_id="XP_022217140.2" /db_xref="GeneID:111070714" /translation="MNIRQKLRLQVITPDIYIKNLSNILYEQRPKPYQVDCIVLGLQP GTMRPFISTLDMLGVPNELDDFVAIGKRSPQLHATCEALWKPKMEPADLLQTISSSIL ADTDPKVTIGALVYVVERGRITESTVEIEED" misc_feature <285..635 /gene="LOC111070714" /note="The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid. N-terminal nucleophile (NTN-) hydrolase superfamily, which contains a...; Region: Ntn_hydrolase; cl00467" /db_xref="CDD:469781" ORIGIN 1 taaaaatggc cacacttctg ataaatttaa aacattgtag ccgcagaaac taaacaacta 61 aagaaagaaa gaaatcatag caatatgatt taaagtatca atcaaatgtc ttcaactgca 121 agcaacacgg cacatagtgt tggaggtagc atggtggcca tgcaaggcat ggactgtgtg 181 gccattgcta cggatcatgc ggctgacaat aatttgttca gaggcccaag aatgatatta 241 tagccgtgtg catgaacatc cgccagaagt tgcgattaca ggtgataacg ccagacatat 301 atatcaagaa tctgtccaac atattgtacg aacaacgccc gaaaccctat caagtggact 361 gcattgtgct tggcctccag cccggtacaa tgaggccgtt catttccacg ctggatatgc 421 ttggagtccc aaatgaactg gacgacttcg ttgcaattgg aaagcgcagc ccgcagcttc 481 atgctacgtg cgaggctctg tggaaaccaa agatggaacc tgcggatctg ttgcagacta 541 tttcgtcatc cattttggcg gataccgacc ccaaagtaac cattggtgcc cttgtctatg 601 ttgttgaaag aggcaggata acagagtcca cagtggagat tgaagaggac taggcaactt 661 aatataattc tgtgtgacat attgtttagg aaatcaaaaa aaaaaatcac gcaaaataaa 721 atgcgctcaa actgcacaca aacacacaca ca