Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361447 782 bp mRNA linear INV 14-MAY-2021 (LOC111070714), transcript variant X1, mRNA. ACCESSION XM_022361447 VERSION XM_022361447.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361447.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..782 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..782 /gene="LOC111070714" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 14 samples with support for all annotated introns" /db_xref="GeneID:111070714" CDS 105..683 /gene="LOC111070714" /codon_start=1 /product="proteasome subunit beta type-3-like isoform X1" /protein_id="XP_022217139.2" /db_xref="GeneID:111070714" /translation="MSSTASNTAHSVGGSMVAMQGMDCVAIATDHAADNNLFRVSRRL FCGFEGPKNDIIAVCMNIRQKLRLQVITPDIYIKNLSNILYEQRPKPYQVDCIVLGLQ PGTMRPFISTLDMLGVPNELDDFVAIGKRSPQLHATCEALWKPKMEPADLLQTISSSI LADTDPKVTIGALVYVVERGRITESTVEIEED" misc_feature 141..665 /gene="LOC111070714" /note="The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid. N-terminal nucleophile (NTN-) hydrolase superfamily, which contains a...; Region: Ntn_hydrolase; cl00467" /db_xref="CDD:469781" ORIGIN 1 aaaaatggcc acacttctga taaatttaaa acattgtagc cgcagaaact aaacaactaa 61 agaaagaaag aaatcatagc aatatgattt aaagtatcaa tcaaatgtct tcaactgcaa 121 gcaacacggc acatagtgtt ggaggtagca tggtggccat gcaaggcatg gactgtgtgg 181 ccattgctac ggatcatgcg gctgacaata atttgttcag agtaagtcgc cgtttgtttt 241 gtgggttcga agggcccaag aatgatatta tagccgtgtg catgaacatc cgccagaagt 301 tgcgattaca ggtgataacg ccagacatat atatcaagaa tctgtccaac atattgtacg 361 aacaacgccc gaaaccctat caagtggact gcattgtgct tggcctccag cccggtacaa 421 tgaggccgtt catttccacg ctggatatgc ttggagtccc aaatgaactg gacgacttcg 481 ttgcaattgg aaagcgcagc ccgcagcttc atgctacgtg cgaggctctg tggaaaccaa 541 agatggaacc tgcggatctg ttgcagacta tttcgtcatc cattttggcg gataccgacc 601 ccaaagtaac cattggtgcc cttgtctatg ttgttgaaag aggcaggata acagagtcca 661 cagtggagat tgaagaggac taggcaactt aatataattc tgtgtgacat attgtttagg 721 aaatcaaaaa aaaaaatcac gcaaaataaa atgcgctcaa actgcacaca aacacacaca 781 ca