Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura proteasome subunit beta type-3-like


LOCUS       XM_022361447             782 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070714), transcript variant X1, mRNA.
ACCESSION   XM_022361447
VERSION     XM_022361447.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361447.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..782
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..782
                     /gene="LOC111070714"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 14 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111070714"
     CDS             105..683
                     /gene="LOC111070714"
                     /codon_start=1
                     /product="proteasome subunit beta type-3-like isoform X1"
                     /protein_id="XP_022217139.2"
                     /db_xref="GeneID:111070714"
                     /translation="MSSTASNTAHSVGGSMVAMQGMDCVAIATDHAADNNLFRVSRRL
                     FCGFEGPKNDIIAVCMNIRQKLRLQVITPDIYIKNLSNILYEQRPKPYQVDCIVLGLQ
                     PGTMRPFISTLDMLGVPNELDDFVAIGKRSPQLHATCEALWKPKMEPADLLQTISSSI
                     LADTDPKVTIGALVYVVERGRITESTVEIEED"
     misc_feature    141..665
                     /gene="LOC111070714"
                     /note="The Ntn hydrolases (N-terminal nucleophile) are a
                     diverse superfamily of of enzymes that are activated
                     autocatalytically via an N-terminally lcated nucleophilic
                     amino acid. N-terminal nucleophile (NTN-) hydrolase
                     superfamily, which contains a...; Region: Ntn_hydrolase;
                     cl00467"
                     /db_xref="CDD:469781"
ORIGIN      
        1 aaaaatggcc acacttctga taaatttaaa acattgtagc cgcagaaact aaacaactaa
       61 agaaagaaag aaatcatagc aatatgattt aaagtatcaa tcaaatgtct tcaactgcaa
      121 gcaacacggc acatagtgtt ggaggtagca tggtggccat gcaaggcatg gactgtgtgg
      181 ccattgctac ggatcatgcg gctgacaata atttgttcag agtaagtcgc cgtttgtttt
      241 gtgggttcga agggcccaag aatgatatta tagccgtgtg catgaacatc cgccagaagt
      301 tgcgattaca ggtgataacg ccagacatat atatcaagaa tctgtccaac atattgtacg
      361 aacaacgccc gaaaccctat caagtggact gcattgtgct tggcctccag cccggtacaa
      421 tgaggccgtt catttccacg ctggatatgc ttggagtccc aaatgaactg gacgacttcg
      481 ttgcaattgg aaagcgcagc ccgcagcttc atgctacgtg cgaggctctg tggaaaccaa
      541 agatggaacc tgcggatctg ttgcagacta tttcgtcatc cattttggcg gataccgacc
      601 ccaaagtaac cattggtgcc cttgtctatg ttgttgaaag aggcaggata acagagtcca
      661 cagtggagat tgaagaggac taggcaactt aatataattc tgtgtgacat attgtttagg
      721 aaatcaaaaa aaaaaatcac gcaaaataaa atgcgctcaa actgcacaca aacacacaca
      781 ca