Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura probable 39S ribosomal protein L49,


LOCUS       XM_022361445             653 bp    mRNA    linear   INV 14-MAY-2021
            mitochondrial (LOC111070713), mRNA.
ACCESSION   XM_022361445
VERSION     XM_022361445.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361445.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..653
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..653
                     /gene="LOC111070713"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070713"
     CDS             55..594
                     /gene="LOC111070713"
                     /codon_start=1
                     /product="probable 39S ribosomal protein L49,
                     mitochondrial"
                     /protein_id="XP_022217137.2"
                     /db_xref="GeneID:111070713"
                     /translation="MAASTKLLLGSGLCHKLCQLTRSLHTQPARLSSFRSSKEVQTLE
                     QYPEVEPVANAAAWKFVERLLPPQTVPRPVAKTDYPSGWQPQKSDGSDSGYFVARTKN
                     HMVPVYLHTRFRGQRRITVVRRVQGDIWALEKDLRSVVEQARNGKLCATRVNELSGQI
                     HIHGDYVDVLRDHLKAKGF"
     misc_feature    337..591
                     /gene="LOC111070713"
                     /note="Mitochondrial large subunit ribosomal protein
                     (Img2); Region: Img2; pfam05046"
                     /db_xref="CDD:461535"
ORIGIN      
        1 ccgcatatgt aaccccgtag ctgttgtttt tcacgttaaa tttgtataaa aacgatggct
       61 gctagcacga aacttctgct gggcagtggc ctctgccaca aactgtgcca gctgacacgt
      121 tccctgcaca cgcagcccgc acggctgtcc agcttccgat cgtccaagga ggtgcagacc
      181 ctggaacagt atcccgaggt ggagcccgtc gcgaatgcgg ctgcctggaa gtttgtggaa
      241 cgcctgctgc cgccccagac agtgccccgg ccggtggcca aaactgatta cccatccggc
      301 tggcagccac agaagtcgga cggctcggac agcggctatt ttgtggcacg caccaagaat
      361 cacatggtgc ccgtgtatct gcacacccgt ttccgtggcc agcgtcgcat cacggtggtg
      421 cgtcgcgtcc aaggcgacat ctgggccctg gaaaaggatc tgcgttcagt ggtggagcag
      481 gcgcgcaatg gcaaactgtg cgccacgcgc gtcaacgagc tcagcggcca gatacacatc
      541 cacggcgact atgtggatgt cttgcgggat catctcaagg ccaagggctt ctgattgcat
      601 taccttttgt ttgaaataat attagaaata taaaaccaat gcttgtggct gaa