Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361444 1462 bp mRNA linear INV 14-MAY-2021 1-like protein (LOC111070712), mRNA. ACCESSION XM_022361444 VERSION XM_022361444.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361444.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1462 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1462 /gene="LOC111070712" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111070712" CDS 117..1004 /gene="LOC111070712" /codon_start=1 /product="breast cancer metastasis-suppressor 1-like protein" /protein_id="XP_022217136.1" /db_xref="GeneID:111070712" /translation="MHRAQVLTRTPDTLCTNRKMPVKNGDSDGEGDVSGAESERSNSS QGRDSSDEEENNECDSDDSSEMDSSDIERIRAEHIEDLLSLERQFNTLREQYYFERLT WIESQLAEVRSGRSEEFVHPQRDLDKVYRTRIEVADVLRRFRLQNIEHKFLSEEQACV QHLESEKHMAGDNLREELLERIRRLEEDRHNVDISWADWGTDKRQSKVRGPGRKKAVT VTGPYVVYMLREEDIMEDWTIIRKALKRTSTTSSTGPGTGTGPVTPTSGTSALVGPTV GLGLSALSGGVPAMAGASG" misc_feature 348..>701 /gene="LOC111070712" /note="Sds3-like; Region: Sds3; pfam08598" /db_xref="CDD:430099" ORIGIN 1 cgttgtccaa cacttttttg cttcagctct agaatcgcaa aagtttccat cagatttgac 61 gccattgttc ccatcagatt tgacgcaatt gttccagtgg aaaatccaaa ttgtgcatgc 121 atcgagcaca ggttttgacc cgtactccgg acacactctg cacgaacagg aaaatgccag 181 tgaaaaatgg tgattccgat ggggaagggg acgtctctgg ggcagagtca gagcgctcca 241 actccagcca gggccgcgac tcctcggacg aggaggagaa caacgaatgc gactccgatg 301 actcctccga gatggactcc agtgacattg agcgcatccg agccgaacac attgaggatt 361 tgctgagtct ggagaggcag ttcaacacgc tgcgcgagca atattacttt gagcgactca 421 cctggatcga gagccaactg gccgaggtgc gttccggccg ttccgaggag tttgtgcatc 481 cccagaggga cctcgacaag gtctatcgca cacgcataga ggtggccgat gtgctccgaa 541 gatttcgtct gcagaatatc gaacacaagt tcctgtccga ggagcaggcg tgcgtccagc 601 acttggagag cgagaagcat atggcgggcg acaacctgcg agaggaactg ctggagcgga 661 tacgccgcct ggaagaggat cgccacaacg tggacatctc ctgggccgac tggggcacgg 721 acaagcgaca gagcaaggtg cgcgggccgg ggcgcaagaa ggccgtcact gtcacgggtc 781 cctatgtggt gtatatgctg cgcgaggagg acatcatgga ggactggacg atcatcagga 841 aggcgctcaa gcgcacttcc accaccagtt caacgggtcc gggcacgggc acgggcccag 901 tgacacccac atcggggacg agcgccctgg ttggacccac tgttggactg ggtctctcgg 961 cactcagtgg cggtgttccg gcaatggccg gtgccagtgg atagcggtgg gggactgctg 1021 cttgcgcccc catgcgtacc tgacggtggc agaggcagca gcagctgcaa cggcagaagc 1081 aacagcagag cttctcccta tcgactcccc catccacacc gccactctcc tcatcccgtt 1141 ttcccgccca cttctcccac tgtggcgatc catgacgggg aggacagtaa acgttaaatg 1201 gtaggactgg gagtcgtgtc gtcccacgtg ctaagtcacc ccacccccag tcacagcacg 1261 tgacccaccc tccaccaccc ccaatcccac attatctccc ccctaaatag ctagatgtag 1321 tttaaggcac agttcgcact ctcaatgtaa atttccactg caaccaggcc gatcccttcg 1381 atgtaattta tgctctatat gtttaagcaa ataaagtaaa tgcaattatt ttgtgactgc 1441 aaggtactgc ctgcagcctt tc