Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura protein bcn92 (LOC111070709), mRNA.


LOCUS       XM_022361442             732 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022361442
VERSION     XM_022361442.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361442.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..732
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..732
                     /gene="LOC111070709"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070709"
     CDS             168..446
                     /gene="LOC111070709"
                     /codon_start=1
                     /product="protein bcn92"
                     /protein_id="XP_022217134.1"
                     /db_xref="GeneID:111070709"
                     /translation="MSTRRQAITLYRNLLRESEKLPAYNFRMYAVRKIRDTFRANKAI
                     GDFAEIDRQMEAGKQNLELLRRQVIIGHLYKADKLVIENKKTLSPLDD"
     misc_feature    183..389
                     /gene="LOC111070709"
                     /note="LYR (leucine-tyrosine-arginine) motif found in LYR
                     motif-containing protein 4 (LYRM4) and similar proteins;
                     Region: Complex1_LYR_LYRM4; cd20264"
                     /db_xref="CDD:380759"
     misc_feature    order(186..191,264..269,276..281,288..293,315..317,
                     324..326,345..347,357..359)
                     /gene="LOC111070709"
                     /note="phosphopantetheine binding site [chemical binding];
                     other site"
                     /db_xref="CDD:380759"
     misc_feature    order(189..191,198..203,210..215,237..245,249..254,
                     261..266,270..275,282..284,291..293,354..356,363..368,
                     375..377)
                     /gene="LOC111070709"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:380759"
ORIGIN      
        1 catatgccac aatgtatttt tttatgtcat caagcggcac aaaataaaga aaccagaaac
       61 ccccattcac agctataaat cgacaataac acgatattat caattaaaac gagcttcaaa
      121 ttacacctag cacgcgcccc tctgcgccac ctgctcagca taacaagatg tcaacacgtc
      181 gccaggccat cacgctgtac cggaatttat tgcgggaatc ggaaaagctg ccagcttaca
      241 actttagaat gtacgctgtt cgcaagatac gcgacacatt ccgcgccaac aaggccattg
      301 gagactttgc tgaaatcgat cgtcaaatgg aggcgggcaa acagaatctg gagctgttac
      361 ggcggcaggt catcatcggc cacctataca aggcggacaa gctggtgatc gagaataaga
      421 aaacactaag ccccttggat gactgagagg acgccgccaa gcaggacttt cccctgctgt
      481 acaaaagcct gttcgcagat taatatttac aactcgaaag actcgttaca cacaattcta
      541 gttggataaa gctttttgcc ccattgttga tcttatggat gtcaagttat ataggcctta
      601 tttttgaacc accagtgaaa gaatcatcgc tatcgtttgc tagcaaaaaa caccaattta
      661 atattatgtt taaaaacaat atgaaattat atatacatac atacatatat atatattaac
      721 gttataaata gg