Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361442 732 bp mRNA linear INV 14-MAY-2021 ACCESSION XM_022361442 VERSION XM_022361442.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361442.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..732 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..732 /gene="LOC111070709" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111070709" CDS 168..446 /gene="LOC111070709" /codon_start=1 /product="protein bcn92" /protein_id="XP_022217134.1" /db_xref="GeneID:111070709" /translation="MSTRRQAITLYRNLLRESEKLPAYNFRMYAVRKIRDTFRANKAI GDFAEIDRQMEAGKQNLELLRRQVIIGHLYKADKLVIENKKTLSPLDD" misc_feature 183..389 /gene="LOC111070709" /note="LYR (leucine-tyrosine-arginine) motif found in LYR motif-containing protein 4 (LYRM4) and similar proteins; Region: Complex1_LYR_LYRM4; cd20264" /db_xref="CDD:380759" misc_feature order(186..191,264..269,276..281,288..293,315..317, 324..326,345..347,357..359) /gene="LOC111070709" /note="phosphopantetheine binding site [chemical binding]; other site" /db_xref="CDD:380759" misc_feature order(189..191,198..203,210..215,237..245,249..254, 261..266,270..275,282..284,291..293,354..356,363..368, 375..377) /gene="LOC111070709" /note="trimer interface [polypeptide binding]; other site" /db_xref="CDD:380759" ORIGIN 1 catatgccac aatgtatttt tttatgtcat caagcggcac aaaataaaga aaccagaaac 61 ccccattcac agctataaat cgacaataac acgatattat caattaaaac gagcttcaaa 121 ttacacctag cacgcgcccc tctgcgccac ctgctcagca taacaagatg tcaacacgtc 181 gccaggccat cacgctgtac cggaatttat tgcgggaatc ggaaaagctg ccagcttaca 241 actttagaat gtacgctgtt cgcaagatac gcgacacatt ccgcgccaac aaggccattg 301 gagactttgc tgaaatcgat cgtcaaatgg aggcgggcaa acagaatctg gagctgttac 361 ggcggcaggt catcatcggc cacctataca aggcggacaa gctggtgatc gagaataaga 421 aaacactaag ccccttggat gactgagagg acgccgccaa gcaggacttt cccctgctgt 481 acaaaagcct gttcgcagat taatatttac aactcgaaag actcgttaca cacaattcta 541 gttggataaa gctttttgcc ccattgttga tcttatggat gtcaagttat ataggcctta 601 tttttgaacc accagtgaaa gaatcatcgc tatcgtttgc tagcaaaaaa caccaattta 661 atattatgtt taaaaacaat atgaaattat atatacatac atacatatat atatattaac 721 gttataaata gg