PREDICTED: Drosophila obscura protein lin-52 homolog

LOCUS       XM_022361441             953 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070708), mRNA.
ACCESSION   XM_022361441
VERSION     XM_022361441.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361441.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..953
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..953
                     /gene="LOC111070708"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070708"
     CDS             188..673
                     /gene="LOC111070708"
                     /codon_start=1
                     /product="protein lin-52 homolog"
                     /protein_id="XP_022217133.1"
                     /db_xref="GeneID:111070708"
                     /translation="MSIKTELNNSDLNIELLAPETILKTDDDNAVSGRILTQQQQQKK
                     VTVDPVDSPCKADELMSLETLRESPVQWPERFPGMDEFLTMCDTPMYSPSTEPPSTLT
                     AEDMAKINRLSKMTPDELIAKIKSMHDEIYQLGLMEAKEMSRGKLLEIFDCNRNPKRH
                     I"
     misc_feature    362..640
                     /gene="LOC111070708"
                     /note="Retinal tissue protein; Region: LIN52; pfam10044"
                     /db_xref="CDD:462950"
ORIGIN      
        1 catttcatta gcattttgaa gacttacaac actgcccaga gatattcata tagatgtatc
       61 ttttacgata gttccgcctt agctattcag aatgtgccag ccctaagctc tgcccacttt
      121 gtcatcccta ggacgccagc ccgacgcaat agttgttttt atccgtaaaa gttgctgctg
      181 ctctaaaatg agcatcaaaa cagagttaaa caattcggat ctgaacatag aactgctggc
      241 tccagaaacc atactaaaaa ctgatgacga caatgcagtg tcggggcgca ttttaacaca
      301 gcagcagcaa cagaaaaagg ttacggtgga tccagtcgac tccccatgca aagcggacga
      361 gctcatgtcg ctggaaacgc tccgcgaatc gccggtacaa tggcccgaga gatttcctgg
      421 catggatgaa ttcctcacaa tgtgcgacac acctatgtac tcacccagca cggaaccacc
      481 gagcaccctg accgccgagg acatggcaaa gataaaccgt ctgtccaaga tgacgcccga
      541 tgaattgata gcgaagatca agagcatgca tgatgaaatc taccaactgg gcctaatgga
      601 ggccaaggag atgtcccgtg gcaagctgtt ggaaatcttc gattgtaatc gtaatcccaa
      661 gcgtcacatc tgacccaaat tacgccattt cagaggcgta tgggatggga ccaccctccg
      721 accatttcct ggtgcccatc caaagaatcc ttagttttgt taatatacac cacatgcgca
      781 ccctatacta ttgcacgccc tacccacaac ctaacggcaa tatatattta tatttatatt
      841 gttaattttt gataataata ataattgcct gcataaaata tgcacgccgc gacaaaccaa
      901 gagaatgtta gctataagaa ttgtacattg aatacacatt tttaatacac aga