Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361424 1397 bp mRNA linear INV 14-MAY-2021 (LOC111070697), mRNA. ACCESSION XM_022361424 VERSION XM_022361424.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; corrected model; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361424.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 1% of CDS bases frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-906 JAECWW010000165.1 549386-550291 c 907-1026 JAECWW010000165.1 549265-549384 c 1027-1397 JAECWW010000165.1 548832-549202 c FEATURES Location/Qualifiers source 1..1397 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1397 /gene="LOC111070697" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns" /db_xref="GeneID:111070697" CDS 1..1374 /gene="LOC111070697" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: uncharacterized protein LOC111070697" /protein_id="XP_022217116.2" /db_xref="GeneID:111070697" /translation="MDNMSITRLKLLALLAFLLLGIGGVQAKYGDLAGNWLVDYGQAE LRVFSDGSEQLQLHIYNVQPQDAALDYHFVVRSSDELRALANRTVPRQDFNASGSWLG TVEVTGKRFGYSELLVELHTAGGAIESFPQPLPIAVLRDRVVDERVTTYVSAALALLM FLNLGTVLDLQRLQGIVCRPVGPVVGIVSRFVLMPALGFGLGRALWPGQQPLQLALFY TALAPSGGLANVCAVFLKGNINLSIATTTINSLLALAFMPLWIMVLGRLVYDDDELTV PFGQLSGGAAALVACLAIGLLLRLCVPKTTLFIFRFLKPLSVVLSLCLVGLTVGLNWF VFAEFTWQVLVAALCLPVAGYLATYLLSKLLCRSPTDALTLAIETSVLNMTMPIVLLQ ASQLEQPQLDLILVVPIAASLLSLVLVIVFYGVRRCLGWNVRQDEHAFDHKQLMAEHD EAVYQRP" misc_feature 388..1266 /gene="LOC111070697" /note="Predicted Na+-dependent transporter YfeH [General function prediction only]; Region: YfeH; COG0385" /db_xref="CDD:440154" ORIGIN 1 atggacaaca tgtcgatcac tagactgaag ctcctggccc tcctggcatt cctcctgctg 61 ggaatcggcg gcgttcaggc caaatacggg gacttggccg gcaattggct ggtggattac 121 ggccaggccg agctccgtgt tttcagcgat ggaagcgagc agcttcagct gcacatttac 181 aatgtccagc cccaggatgc cgccttggac taccattttg tggtgcgctc aagcgacgag 241 ctgagggccc tggcaaacag gacggtaccc cgtcaggatt tcaatgccag cggcagttgg 301 ttggggacgg tggaagtgac gggcaaacgt ttcggttata gcgagctgct ggtggagctg 361 cacaccgctg gcggcgcaat cgagtcattc ccccagccac tgcccattgc ggtgttgcgg 421 gatcgcgttg tcgatgagcg cgtaaccaca tatgtgtcgg cggctctcgc cctgctgatg 481 ttcctcaatc tgggcaccgt gctggacctg caacgcctgc agggcatcgt gtgccggccc 541 gtgggtcctg tggtgggcat cgtcagtcgt ttcgtgctaa tgccagccct gggctttggc 601 ctaggccgtg ccctgtggcc ggggcagcag cccctccagc tggccctctt ttacactgct 661 ctggcaccca gcggcggtct ggccaatgtg tgcgccgttt tcctcaaggg gaacatcaac 721 ctgtcgattg ccaccaccac catcaacagc ctgctagcgc tggcatttat gccgctgtgg 781 atcatggtcc tgggccggct cgtctacgat gacgatgaac tgacggtgcc cttcggtcag 841 ctatctggcg gcgcggcggc tctggtagcc tgcctggcca ttggcctcct gctgcgcctc 901 tgcgtgccaa agacgacgct gtttatcttc cgcttcctca agccgctctc ggtggtgctc 961 agcctgtgtc tggtggggct gacggtgggc ctcaattggt ttgtctttgc cgagttcacc 1021 tggcaggtgc tggtggctgc tctctgcctg cccgttgccg gctatctggc cacctacttg 1081 ctgtccaagc tgctctgccg ctcgcccacc gatgccctga cactggccat cgagaccagt 1141 gtgctgaaca tgaccatgcc cattgtcctg ctgcaggcca gccagctgga gcagccgcag 1201 ctggatctca tcctggtggt gcccattgcg gcatcgctac tctccctagt gctcgtcatc 1261 gtcttctatg gggtgcgccg ctgcctcgga tggaatgtgc gccaggatga gcacgccttc 1321 gatcacaaac agctgatggc tgagcacgac gaggccgtct atcagcggcc ttgagaggcg 1381 tcgcttccgc tccactc