Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111070697


LOCUS       XM_022361424            1397 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070697), mRNA.
ACCESSION   XM_022361424
VERSION     XM_022361424.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; corrected model; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361424.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio   :: 1% of CDS bases
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-906               JAECWW010000165.1  549386-550291       c
            907-1026            JAECWW010000165.1  549265-549384       c
            1027-1397           JAECWW010000165.1  548832-549202       c
FEATURES             Location/Qualifiers
     source          1..1397
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1397
                     /gene="LOC111070697"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 2 Proteins, and 98% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     12 samples with support for all annotated introns"
                     /db_xref="GeneID:111070697"
     CDS             1..1374
                     /gene="LOC111070697"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: uncharacterized protein
                     LOC111070697"
                     /protein_id="XP_022217116.2"
                     /db_xref="GeneID:111070697"
                     /translation="MDNMSITRLKLLALLAFLLLGIGGVQAKYGDLAGNWLVDYGQAE
                     LRVFSDGSEQLQLHIYNVQPQDAALDYHFVVRSSDELRALANRTVPRQDFNASGSWLG
                     TVEVTGKRFGYSELLVELHTAGGAIESFPQPLPIAVLRDRVVDERVTTYVSAALALLM
                     FLNLGTVLDLQRLQGIVCRPVGPVVGIVSRFVLMPALGFGLGRALWPGQQPLQLALFY
                     TALAPSGGLANVCAVFLKGNINLSIATTTINSLLALAFMPLWIMVLGRLVYDDDELTV
                     PFGQLSGGAAALVACLAIGLLLRLCVPKTTLFIFRFLKPLSVVLSLCLVGLTVGLNWF
                     VFAEFTWQVLVAALCLPVAGYLATYLLSKLLCRSPTDALTLAIETSVLNMTMPIVLLQ
                     ASQLEQPQLDLILVVPIAASLLSLVLVIVFYGVRRCLGWNVRQDEHAFDHKQLMAEHD
                     EAVYQRP"
     misc_feature    388..1266
                     /gene="LOC111070697"
                     /note="Predicted Na+-dependent transporter YfeH [General
                     function prediction only]; Region: YfeH; COG0385"
                     /db_xref="CDD:440154"
ORIGIN      
        1 atggacaaca tgtcgatcac tagactgaag ctcctggccc tcctggcatt cctcctgctg
       61 ggaatcggcg gcgttcaggc caaatacggg gacttggccg gcaattggct ggtggattac
      121 ggccaggccg agctccgtgt tttcagcgat ggaagcgagc agcttcagct gcacatttac
      181 aatgtccagc cccaggatgc cgccttggac taccattttg tggtgcgctc aagcgacgag
      241 ctgagggccc tggcaaacag gacggtaccc cgtcaggatt tcaatgccag cggcagttgg
      301 ttggggacgg tggaagtgac gggcaaacgt ttcggttata gcgagctgct ggtggagctg
      361 cacaccgctg gcggcgcaat cgagtcattc ccccagccac tgcccattgc ggtgttgcgg
      421 gatcgcgttg tcgatgagcg cgtaaccaca tatgtgtcgg cggctctcgc cctgctgatg
      481 ttcctcaatc tgggcaccgt gctggacctg caacgcctgc agggcatcgt gtgccggccc
      541 gtgggtcctg tggtgggcat cgtcagtcgt ttcgtgctaa tgccagccct gggctttggc
      601 ctaggccgtg ccctgtggcc ggggcagcag cccctccagc tggccctctt ttacactgct
      661 ctggcaccca gcggcggtct ggccaatgtg tgcgccgttt tcctcaaggg gaacatcaac
      721 ctgtcgattg ccaccaccac catcaacagc ctgctagcgc tggcatttat gccgctgtgg
      781 atcatggtcc tgggccggct cgtctacgat gacgatgaac tgacggtgcc cttcggtcag
      841 ctatctggcg gcgcggcggc tctggtagcc tgcctggcca ttggcctcct gctgcgcctc
      901 tgcgtgccaa agacgacgct gtttatcttc cgcttcctca agccgctctc ggtggtgctc
      961 agcctgtgtc tggtggggct gacggtgggc ctcaattggt ttgtctttgc cgagttcacc
     1021 tggcaggtgc tggtggctgc tctctgcctg cccgttgccg gctatctggc cacctacttg
     1081 ctgtccaagc tgctctgccg ctcgcccacc gatgccctga cactggccat cgagaccagt
     1141 gtgctgaaca tgaccatgcc cattgtcctg ctgcaggcca gccagctgga gcagccgcag
     1201 ctggatctca tcctggtggt gcccattgcg gcatcgctac tctccctagt gctcgtcatc
     1261 gtcttctatg gggtgcgccg ctgcctcgga tggaatgtgc gccaggatga gcacgccttc
     1321 gatcacaaac agctgatggc tgagcacgac gaggccgtct atcagcggcc ttgagaggcg
     1381 tcgcttccgc tccactc