Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura transmembrane emp24 domain-containing


LOCUS       XM_022361421             756 bp    mRNA    linear   INV 14-MAY-2021
            protein 2 (LOC111070695), mRNA.
ACCESSION   XM_022361421
VERSION     XM_022361421.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361421.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..756
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..756
                     /gene="LOC111070695"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070695"
     CDS             98..724
                     /gene="LOC111070695"
                     /codon_start=1
                     /product="transmembrane emp24 domain-containing protein 2"
                     /protein_id="XP_022217113.1"
                     /db_xref="GeneID:111070695"
                     /translation="MQPMLAKLLLTLCGLCLLATAGQGFIVSVDAHNEECFFENVEGG
                     TKFGVTFEVIDGGFLDVDIKISGPENHVMHESEKESSGKYTFVAPAKGTYTVCFNNER
                     SSMTPKLVMFSIDVGEAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHV
                     RDKIHRSVNESTNSRVVLWSTFEALVLILMTVGQVYYLKRFFEVKRVV"
     misc_feature    167..706
                     /gene="LOC111070695"
                     /note="emp24/gp25L/p24 family/GOLD; Region: EMP24_GP25L;
                     pfam01105"
                     /db_xref="CDD:426051"
ORIGIN      
        1 ccctatcaaa caactcgaca aactacgtgg ctgcgaacgg gctggcagaa tatagcaatt
       61 acctgggcaa aaaaatatac aaactcgagg taacaatatg caaccgatgc tcgccaagct
      121 gctgctgact ttgtgcggcc tttgcctgct ggccaccgcc ggccagggct tcatagtcag
      181 cgtagatgcc cacaacgagg agtgcttttt cgagaatgtc gaaggcggca ccaaattcgg
      241 cgtcactttt gaggtaattg atggcggctt cctggacgtg gacattaaga tcagcggccc
      301 cgagaaccat gtgatgcacg agagcgaaaa ggagtcgtcc gggaagtaca cgtttgtggc
      361 acccgccaag ggcacatata cggtctgctt caataacgag cgcagcagca tgacccccaa
      421 gctggtcatg ttctccatcg atgtgggtga ggcgccgcag cgtgcaccgg gcgcacctgg
      481 cgaggaggag gtcggtcaca ccaagctcga ggacatgatc cgtgagctct cgggcacgtt
      541 gaccagcgtc aagcacgagc aggagtacat gcacgttcgc gataagatcc atcgatcggt
      601 gaacgagagc accaactcgc gtgtggtttt gtggtcgact ttcgaggcac tcgtccttat
      661 tctgatgacc gtgggccagg tctactatct taagcgcttc tttgaggtca agcgcgttgt
      721 gtaatgaaaa caaaacaaag tggaatggcg cggagc