Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361421 756 bp mRNA linear INV 14-MAY-2021 protein 2 (LOC111070695), mRNA. ACCESSION XM_022361421 VERSION XM_022361421.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361421.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..756 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..756 /gene="LOC111070695" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111070695" CDS 98..724 /gene="LOC111070695" /codon_start=1 /product="transmembrane emp24 domain-containing protein 2" /protein_id="XP_022217113.1" /db_xref="GeneID:111070695" /translation="MQPMLAKLLLTLCGLCLLATAGQGFIVSVDAHNEECFFENVEGG TKFGVTFEVIDGGFLDVDIKISGPENHVMHESEKESSGKYTFVAPAKGTYTVCFNNER SSMTPKLVMFSIDVGEAPQRAPGAPGEEEVGHTKLEDMIRELSGTLTSVKHEQEYMHV RDKIHRSVNESTNSRVVLWSTFEALVLILMTVGQVYYLKRFFEVKRVV" misc_feature 167..706 /gene="LOC111070695" /note="emp24/gp25L/p24 family/GOLD; Region: EMP24_GP25L; pfam01105" /db_xref="CDD:426051" ORIGIN 1 ccctatcaaa caactcgaca aactacgtgg ctgcgaacgg gctggcagaa tatagcaatt 61 acctgggcaa aaaaatatac aaactcgagg taacaatatg caaccgatgc tcgccaagct 121 gctgctgact ttgtgcggcc tttgcctgct ggccaccgcc ggccagggct tcatagtcag 181 cgtagatgcc cacaacgagg agtgcttttt cgagaatgtc gaaggcggca ccaaattcgg 241 cgtcactttt gaggtaattg atggcggctt cctggacgtg gacattaaga tcagcggccc 301 cgagaaccat gtgatgcacg agagcgaaaa ggagtcgtcc gggaagtaca cgtttgtggc 361 acccgccaag ggcacatata cggtctgctt caataacgag cgcagcagca tgacccccaa 421 gctggtcatg ttctccatcg atgtgggtga ggcgccgcag cgtgcaccgg gcgcacctgg 481 cgaggaggag gtcggtcaca ccaagctcga ggacatgatc cgtgagctct cgggcacgtt 541 gaccagcgtc aagcacgagc aggagtacat gcacgttcgc gataagatcc atcgatcggt 601 gaacgagagc accaactcgc gtgtggtttt gtggtcgact ttcgaggcac tcgtccttat 661 tctgatgacc gtgggccagg tctactatct taagcgcttc tttgaggtca agcgcgttgt 721 gtaatgaaaa caaaacaaag tggaatggcg cggagc