Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361412 1293 bp mRNA linear INV 14-MAY-2021 ACCESSION XM_022361412 VERSION XM_022361412.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361412.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1293 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1293 /gene="LOC111070688" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111070688" CDS 184..1125 /gene="LOC111070688" /codon_start=1 /product="FAD synthase" /protein_id="XP_022217104.2" /db_xref="GeneID:111070688" /translation="MLRRTAWLGHIYRRTAAYGSPHAVQSPFNVMSKCCCTATTTTTI TTPVPNPSPPRHNSLLTLNGGKSMATGRTPEAPSPHIVVTAETRARIEQRQRTAFDFF DETLQLYGVEELIFCFNGGKDCTVLLDLLMRYCRQQGISSRDIPMLYIKSDDAFAEID EFVARCVQHYDVQLIEYEESLKEALTHMSADMPRIKGVFVGSRNTDPYCEHLAPMQPT DNGWPPMMRLNPLLEWSYHDVWHYIHLNCVAYCPLYDKGYTSIGYRSNTVPNPHLKRL DSCSSSSSPCSGTPGDFRPAWELADPTTERAGRLPRK" misc_feature 463..996 /gene="LOC111070688" /note="FAD synthase; Region: FAD_synthase; cd23948" /db_xref="CDD:467513" ORIGIN 1 tctttctaac agctgtccct ccggcttggg ttattttatt tattattagc aatcaatcat 61 taatattagc aatgttggtt gtggacagtt agacgcagcg gaagagtcag agaattaaat 121 gtgaaaacag tcagcagttg gccgcattct ataccagcac cggacagatc tctcagcgag 181 tggatgctac gtcgcacagc ctggctggga cacatctatc gtcgtaccgc cgcatacgga 241 agcccccatg cggtacagag ccccttcaac gtcatgagta aatgctgctg caccgccacc 301 accaccacga cgatcacaac acccgttccg aatccctcgc cgccacgcca caacagttta 361 ctgaccctga acgggggcaa gagtatggcc accggccgta ctcccgaggc gccgtcgccc 421 cacattgtgg tcacagccga gacgcgagcg cgaatcgagc agcgtcagcg gacggccttt 481 gacttcttcg acgagaccct gcagctgtat ggcgtggagg agctcatatt ctgctttaac 541 ggcggcaagg actgcaccgt gctgctggac ctgctgatgc gctattgccg ccagcagggc 601 atcagcagtc gggacatacc catgctgtac atcaagtcgg acgacgcctt tgcggagatc 661 gacgagtttg tggcgcgctg cgtgcagcac tacgacgtcc agctgatcga gtacgaagag 721 tcgctaaagg aggccctcac ccacatgtcg gcggatatgc cgcgcatcaa gggcgtattt 781 gtgggcagcc gaaacacgga tccctactgc gagcacctcg cacccatgca gcccacggac 841 aatggctggc cgcctatgat gcggctgaac ccgcttctgg agtggtccta ccatgacgtc 901 tggcactaca ttcatttgaa ctgcgtggcc tactgcccgc tgtatgacaa gggatacacc 961 tccattggct acaggtccaa cacggtgccc aatccgcatt tgaaacgcct cgactcgtgc 1021 agcagcagca gcagcccctg cagcgggaca ccgggcgact ttcgacctgc atgggagctg 1081 gccgatccca caacggagcg ggccgggcgc ctgccgcgaa agtaggcctc agggtgacag 1141 agtaaaagtg cctcagcgag tcagtcggtg gtgtagaaca atacctgtat acctttaaaa 1201 ttagttagtc acaaattgta tatatatata tatatgggtg tctgggtgca tcggctattg 1261 acgatctaca aatataaatt tagttttttt ata