Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura ELAV-like protein 2 (LOC111070685),


LOCUS       XM_022361410            1206 bp    mRNA    linear   INV 14-MAY-2021
            transcript variant X3, mRNA.
ACCESSION   XM_022361410
VERSION     XM_022361410.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361410.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1206
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1206
                     /gene="LOC111070685"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 8 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070685"
     CDS             397..1191
                     /gene="LOC111070685"
                     /codon_start=1
                     /product="ELAV-like protein 4 isoform X3"
                     /protein_id="XP_022217102.1"
                     /db_xref="GeneID:111070685"
                     /translation="MTNAMDIVKNGSANGSVDGSNDESRTNLIVNYLPQTMTQEEMRS
                     LFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAV
                     NTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSR
                     ILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ
                     IAPPLTAYLTPQAAAATRRLAGALPNAGRISIGKCPMLAVNRGLRR"
     misc_feature    463..>1143
                     /gene="LOC111070685"
                     /note="ELAV/HuD family splicing factor; Region:
                     ELAV_HUD_SF; TIGR01661"
                     /db_xref="CDD:273741"
ORIGIN      
        1 aattcaattt taaacgtttt cgacagcgaa cgatacagaa cttaactaaa attaaaaaga
       61 gagaatacgt tttttttcgc gatcgtagtt gatctaaaaa ccccacacaa ccgaactaac
      121 aaccacagca acaaccactt ctgcggctaa acaacttcac gggacttgtg caaagcgcag
      181 tcgaaactaa aattaaatta aacaaaaaaa aaaacataaa aataaaacct aattcgtaag
      241 cgttaacaaa accaagcagt gagattaatt actaagcgaa caacagcaac catttaacaa
      301 ggaaaaaact caaccaacaa aacaatacaa aaaaaaaatc gcgttacccc gaaatcgaaa
      361 ccggaaccaa aagaacaaaa aaaaaccgaa agcaaaatga ccaacgccat ggatattgtg
      421 aagaacggca gcgctaatgg ctccgtggat ggcagcaatg atgagtcgcg caccaatttg
      481 atcgtcaact atctgccaca gaccatgacg caagaggaga tgcgatcact cttctcgagc
      541 atcggtgagc tcgagagttg caaactggtg cgtgataaag tctcaggtaa tttggtcttg
      601 ccagcatcgt tgaccgccct caatccggca ctccagcaag gtcaaagcct gggttatggc
      661 tttgtcaact atgtgcgggc cgaggatgct gagaaggctg tgaataccct gaatggtttg
      721 cgtttgcaga acaaagttat taaagtatca tacgcccgtc caagttcaga atctataaag
      781 ggtgctaatt tatatgtatc gggtcttccg aagaatctat cacaaccaga cttggagggg
      841 atgtttgcat cgttcggcaa gataattaca tctcgtatac tctgtgataa tatttccggt
      901 ctatcgaagg gcgtcggttt tatacgtttc gatcaacgca acgaagccga acgggccata
      961 caagagctga atggcaagac acctaagggt tatgccgagc cgattaccgt taagtttgcc
     1021 aacaatccaa gcaacagcgc caaggcccaa attgccccgc ccctgaccgc ctacttgacg
     1081 cctcaggcgg cagcagccac gcgacgtttg gccggcgctc taccaaacgc tggtcgcatc
     1141 agcattggaa agtgtcccat gttagcggtt aacaggggcc tacgaaggtg aattatttat
     1201 ttatga