Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361410 1206 bp mRNA linear INV 14-MAY-2021 transcript variant X3, mRNA. ACCESSION XM_022361410 VERSION XM_022361410.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361410.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1206 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1206 /gene="LOC111070685" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 8 samples with support for all annotated introns" /db_xref="GeneID:111070685" CDS 397..1191 /gene="LOC111070685" /codon_start=1 /product="ELAV-like protein 4 isoform X3" /protein_id="XP_022217102.1" /db_xref="GeneID:111070685" /translation="MTNAMDIVKNGSANGSVDGSNDESRTNLIVNYLPQTMTQEEMRS LFSSIGELESCKLVRDKVSGNLVLPASLTALNPALQQGQSLGYGFVNYVRAEDAEKAV NTLNGLRLQNKVIKVSYARPSSESIKGANLYVSGLPKNLSQPDLEGMFASFGKIITSR ILCDNISGLSKGVGFIRFDQRNEAERAIQELNGKTPKGYAEPITVKFANNPSNSAKAQ IAPPLTAYLTPQAAAATRRLAGALPNAGRISIGKCPMLAVNRGLRR" misc_feature 463..>1143 /gene="LOC111070685" /note="ELAV/HuD family splicing factor; Region: ELAV_HUD_SF; TIGR01661" /db_xref="CDD:273741" ORIGIN 1 aattcaattt taaacgtttt cgacagcgaa cgatacagaa cttaactaaa attaaaaaga 61 gagaatacgt tttttttcgc gatcgtagtt gatctaaaaa ccccacacaa ccgaactaac 121 aaccacagca acaaccactt ctgcggctaa acaacttcac gggacttgtg caaagcgcag 181 tcgaaactaa aattaaatta aacaaaaaaa aaaacataaa aataaaacct aattcgtaag 241 cgttaacaaa accaagcagt gagattaatt actaagcgaa caacagcaac catttaacaa 301 ggaaaaaact caaccaacaa aacaatacaa aaaaaaaatc gcgttacccc gaaatcgaaa 361 ccggaaccaa aagaacaaaa aaaaaccgaa agcaaaatga ccaacgccat ggatattgtg 421 aagaacggca gcgctaatgg ctccgtggat ggcagcaatg atgagtcgcg caccaatttg 481 atcgtcaact atctgccaca gaccatgacg caagaggaga tgcgatcact cttctcgagc 541 atcggtgagc tcgagagttg caaactggtg cgtgataaag tctcaggtaa tttggtcttg 601 ccagcatcgt tgaccgccct caatccggca ctccagcaag gtcaaagcct gggttatggc 661 tttgtcaact atgtgcgggc cgaggatgct gagaaggctg tgaataccct gaatggtttg 721 cgtttgcaga acaaagttat taaagtatca tacgcccgtc caagttcaga atctataaag 781 ggtgctaatt tatatgtatc gggtcttccg aagaatctat cacaaccaga cttggagggg 841 atgtttgcat cgttcggcaa gataattaca tctcgtatac tctgtgataa tatttccggt 901 ctatcgaagg gcgtcggttt tatacgtttc gatcaacgca acgaagccga acgggccata 961 caagagctga atggcaagac acctaagggt tatgccgagc cgattaccgt taagtttgcc 1021 aacaatccaa gcaacagcgc caaggcccaa attgccccgc ccctgaccgc ctacttgacg 1081 cctcaggcgg cagcagccac gcgacgtttg gccggcgctc taccaaacgc tggtcgcatc 1141 agcattggaa agtgtcccat gttagcggtt aacaggggcc tacgaaggtg aattatttat 1201 ttatga