Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361406 980 bp mRNA linear INV 14-MAY-2021 (LOC111070684), mRNA. ACCESSION XM_022361406 VERSION XM_022361406.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361406.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..980 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..980 /gene="LOC111070684" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111070684" CDS 35..748 /gene="LOC111070684" /codon_start=1 /product="lysophospholipase-like protein 1" /protein_id="XP_022217098.1" /db_xref="GeneID:111070684" /translation="MRPALTVVNATSKQTASVIFFHGSGDTGPNVLEWVRFLLGRNLE YGHIKVIYPTAPVQKYTPLNGQESNVWFDRRSVNIAAQESKKSMSQCYESVNQLIEDE VSNGIPASRIIVGGFSMGGALALHTGYHLNAGLAGVFAHSAFLNRNSIVYESLQSSSE QKEQLPELRMFHGERDTLVPIEWGVETFKALQSLGVNGTFQPLKNTLHELKKSSLVDL QEWILEKLPPLENNVQNKL" misc_feature 53..700 /gene="LOC111070684" /note="A functionally diverse superfamily containing proteases, lipases, peroxidases, esterases, epoxide hydrolases and dehalogenases. The catalytic apparatus typically involves three residues (catalytic triad): a serine, a glutamate or aspartate and a...; Region: alpha/beta hydrolases; cl21494" /db_xref="CDD:473884" ORIGIN 1 cctaagtata ttgtcaacaa tagccaaagt caagatgaga cctgctttaa cggtggtaaa 61 tgcaacgagc aaacaaactg catccgttat atttttccat ggctccggcg acactggtcc 121 gaatgtattg gaatgggtgc gctttctact gggacggaat ttggaatacg gccacataaa 181 agtcatttat ccaacagcac cagtgcaaaa gtacacgccg ttgaacggcc aagagtccaa 241 tgtgtggttc gatcgacgct cggtaaacat tgcggcacag gaaagcaaaa agagcatgtc 301 acaatgttac gaaagcgtta atcagcttat cgaagacgag gtctcgaacg gcataccggc 361 cagccgcatc attgtgggcg gcttctcaat gggcggcgcg ttggccttgc acacgggcta 421 ccatttgaat gctggactag cgggtgtctt cgcgcactct gcctttctca accgtaactc 481 catcgtctat gaatcgctgc agtcgagctc cgagcagaag gagcagcttc cagagctccg 541 aatgtttcat ggagagcgcg acaccttggt accgatcgag tggggcgttg agacttttaa 601 agctcttcaa agtttaggtg tcaacggtac attccagcca ttgaagaata cactgcatga 661 actgaaaaaa tcgtcgcttg ttgatctaca ggaatggatt ctagaaaagc tacctccgct 721 tgaaaacaat gtacaaaata aactgtgagc gtatatggca taacaccagc acaactatca 781 gcggcgcaga gacaaggctt gctatcactt gcttgatctt ctacgtgatg atcttctccg 841 ccgtaatgaa aactcagttc ttcctgggca agaatgttgc gtgctgcgaa aataccttta 901 aaaatgtaca taaaattctc cggtaatatg aaaacaaaac aaaaacgtta ataaaactca 961 catatttttg gtatgggaca