Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura lysophospholipase-like protein 1


LOCUS       XM_022361406             980 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070684), mRNA.
ACCESSION   XM_022361406
VERSION     XM_022361406.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361406.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..980
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..980
                     /gene="LOC111070684"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070684"
     CDS             35..748
                     /gene="LOC111070684"
                     /codon_start=1
                     /product="lysophospholipase-like protein 1"
                     /protein_id="XP_022217098.1"
                     /db_xref="GeneID:111070684"
                     /translation="MRPALTVVNATSKQTASVIFFHGSGDTGPNVLEWVRFLLGRNLE
                     YGHIKVIYPTAPVQKYTPLNGQESNVWFDRRSVNIAAQESKKSMSQCYESVNQLIEDE
                     VSNGIPASRIIVGGFSMGGALALHTGYHLNAGLAGVFAHSAFLNRNSIVYESLQSSSE
                     QKEQLPELRMFHGERDTLVPIEWGVETFKALQSLGVNGTFQPLKNTLHELKKSSLVDL
                     QEWILEKLPPLENNVQNKL"
     misc_feature    53..700
                     /gene="LOC111070684"
                     /note="A functionally diverse superfamily containing
                     proteases, lipases, peroxidases, esterases, epoxide
                     hydrolases and dehalogenases. The catalytic apparatus
                     typically involves three residues (catalytic triad): a
                     serine, a glutamate or aspartate and a...; Region:
                     alpha/beta hydrolases; cl21494"
                     /db_xref="CDD:473884"
ORIGIN      
        1 cctaagtata ttgtcaacaa tagccaaagt caagatgaga cctgctttaa cggtggtaaa
       61 tgcaacgagc aaacaaactg catccgttat atttttccat ggctccggcg acactggtcc
      121 gaatgtattg gaatgggtgc gctttctact gggacggaat ttggaatacg gccacataaa
      181 agtcatttat ccaacagcac cagtgcaaaa gtacacgccg ttgaacggcc aagagtccaa
      241 tgtgtggttc gatcgacgct cggtaaacat tgcggcacag gaaagcaaaa agagcatgtc
      301 acaatgttac gaaagcgtta atcagcttat cgaagacgag gtctcgaacg gcataccggc
      361 cagccgcatc attgtgggcg gcttctcaat gggcggcgcg ttggccttgc acacgggcta
      421 ccatttgaat gctggactag cgggtgtctt cgcgcactct gcctttctca accgtaactc
      481 catcgtctat gaatcgctgc agtcgagctc cgagcagaag gagcagcttc cagagctccg
      541 aatgtttcat ggagagcgcg acaccttggt accgatcgag tggggcgttg agacttttaa
      601 agctcttcaa agtttaggtg tcaacggtac attccagcca ttgaagaata cactgcatga
      661 actgaaaaaa tcgtcgcttg ttgatctaca ggaatggatt ctagaaaagc tacctccgct
      721 tgaaaacaat gtacaaaata aactgtgagc gtatatggca taacaccagc acaactatca
      781 gcggcgcaga gacaaggctt gctatcactt gcttgatctt ctacgtgatg atcttctccg
      841 ccgtaatgaa aactcagttc ttcctgggca agaatgttgc gtgctgcgaa aataccttta
      901 aaaatgtaca taaaattctc cggtaatatg aaaacaaaac aaaaacgtta ataaaactca
      961 catatttttg gtatgggaca