PREDICTED: Drosophila obscura probable histone-lysine

LOCUS       XM_022361403            1017 bp    mRNA    linear   INV 14-MAY-2021
            N-methyltransferase set-23 (LOC111070683), mRNA.
ACCESSION   XM_022361403
VERSION     XM_022361403.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361403.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1017
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1017
                     /gene="LOC111070683"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 16 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070683"
     CDS             147..986
                     /gene="LOC111070683"
                     /codon_start=1
                     /product="probable histone-lysine N-methyltransferase
                     set-23"
                     /protein_id="XP_022217095.2"
                     /db_xref="GeneID:111070683"
                     /translation="MAQSRIAVNDDYEHPDNLEYILESVLMPSEDSLDFIQLKNEYNS
                     VILQQCQCEGSCSSNERCSHGGAYRYCPDGKELVQRQTKEKGSIPIMECNAFCDCRPD
                     FCTNRLVQHGPRANLEVFNSTTYKSKGVRTKVNIPCGAFICEYAGEILTISEAKRRLA
                     INEKLGLMNYVLVLNEYTETDDCREEKRQVTIVDPSQRGNIGRYINHSCEPNCQIAAV
                     RIDCPIPKICIFAARNILAQEELSFHYGGEDHHVEDQASDSKPCLCAADSCAGVMPYT
                     AII"
     misc_feature    192..980
                     /gene="LOC111070683"
                     /note="SET (Su(var)3-9, Enhancer-of-zeste, Trithorax)
                     domain superfamily; Region: SET; cl40432"
                     /db_xref="CDD:394802"
     misc_feature    order(525..530,750..767,789..797,873..884)
                     /gene="LOC111070683"
                     /note="active site"
                     /db_xref="CDD:380942"
     misc_feature    order(525..530,753..767,879..881)
                     /gene="LOC111070683"
                     /note="SAM binding site [polypeptide binding]; other site"
                     /db_xref="CDD:380942"
ORIGIN      
        1 tagtctgtgg cgcgtcatcg atattgccac ttgttccatc tatggttatg cagccctagt
       61 ctccagctgt tctttctaaa caatttttca aacaaattcg actagaaaac aaatgtttta
      121 ggaaaatata ggatcgcatt atttcaatgg cacaatctcg aatagcagtg aatgacgact
      181 atgaacaccc agataatcta gaatatattt tagaatctgt tctgatgccc agcgaggaca
      241 gcttagattt cattcagtta aagaacgagt acaactctgt gattttacag caatgtcaat
      301 gcgaaggcag ttgctcaagc aacgaaagat gctcacacgg aggtgcttat aggtactgtc
      361 ctgatggaaa agaattagtt caaaggcaaa ctaaggaaaa aggcagcatc cctattatgg
      421 agtgcaatgc tttctgtgac tgtcgtccag acttttgcac taatcgactt gtgcagcatg
      481 gtccacgagc caatttggaa gtatttaatt cgactacgta caaatccaag ggggtgcgca
      541 cgaaagtaaa cattccttgt ggtgccttca tctgcgaata tgctggtgaa attctaacta
      601 tttctgaagc caaacgacgt ctagctatca atgagaaact gggattaatg aattatgtct
      661 tagtacttaa cgaatacact gagaccgatg actgccgtga ggagaagcga caagtcacca
      721 tcgtagatcc ttctcaacgt ggaaatattg gacgctacat taaccacagc tgtgagccca
      781 attgtcagat agcggcggtg cgaatagact gtcccatacc aaaaatatgt attttcgcag
      841 cacgcaacat tcttgcccag gaagaactga gttttcatta cggcggagaa gatcatcacg
      901 tagaagatca agcaagtgat agcaagcctt gtctctgcgc cgctgatagt tgtgctggtg
      961 ttatgccata tactgcaata atatagatca gacaaaaact cagcttttta agtatgt