Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura LSM12 homolog A (LOC111070682), mRNA.


LOCUS       XM_022361402            1365 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022361402
VERSION     XM_022361402.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361402.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1365
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1365
                     /gene="LOC111070682"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070682"
     CDS             658..1230
                     /gene="LOC111070682"
                     /codon_start=1
                     /product="LSM12 homolog A"
                     /protein_id="XP_022217094.2"
                     /db_xref="GeneID:111070682"
                     /translation="MAAATATAGNAVNDCFNIGSTVMCTTCFNEEVEGEVLAFDHNTK
                     MLILKCRSKTTEELSDIYALNLSLCSNVQVIKECNGNFVDDPQKLNLEQVKMRLRKTV
                     ERRQDYLKSQNADVSSEAQELYRAIAKQYGYNEVSWQGLNIQILNEVTISPPYRVDNV
                     VSSSNNETSCNYIKRIIKQFFNSQTIGGTG"
     misc_feature    697..876
                     /gene="LOC111070682"
                     /note="Like-Sm protein 12, N-terminal domain; Region:
                     LSm12_N; cd01735"
                     /db_xref="CDD:212482"
     misc_feature    order(721..741,745..783,790..804)
                     /gene="LOC111070682"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212482"
     misc_feature    order(775..777,781..783,850..852)
                     /gene="LOC111070682"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:212482"
     misc_feature    838..873
                     /gene="LOC111070682"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212482"
     misc_feature    910..1185
                     /gene="LOC111070682"
                     /note="Anticodon-binding domain; Region: AD; smart00995"
                     /db_xref="CDD:214962"
ORIGIN      
        1 tttgcagccc tacgctcttt cgtgtgttga ccaaacactt ttcgcatatt tttccatttt
       61 ctcaattaca aaacaaaaaa acacgtattt aaaattgact gtacgcttag gctcaatatt
      121 gattaatagt ttttggtcaa cgcaccagtt cgtttcaagc gaaaatattg aaacgcagcg
      181 aatagaaaat cacttccatg aagcgacatc tacgctagag gcagaagcag aaacgtgaat
      241 gtgaaagcca gtccgcggcg gcaaacggca acatcaaaac cgaagaccaa cagtaacaca
      301 gaacagtgta taggaaacag cagcaacaat tacgcttacg tccatcaacc agggccagac
      361 cacacagcca tcgcacagcg ccgatgttgt aaacaactag aactcaatgc tcgcatggat
      421 taattgcaat ttttgatttg acatatcaat tgttgttttg catcacacac ataccacata
      481 ccatactacg tgttcaaagt tgtgtaaaca atcggcacgc cacgcacaga agccagccag
      541 ccagcgcaca ggacacatcc gttgcgaagc tctgcaagat agaaagctgc tctgctcctc
      601 caactcgacc acaggtcgac tccactccac gctccaagtt aagtctaaca attaaagatg
      661 gccgctgcca ctgcaaccgc cggcaatgca gtgaacgact gcttcaacat tggatccaca
      721 gtgatgtgca cgacctgttt caacgaggaa gtggagggcg aggtgctcgc attcgatcat
      781 aacacaaaga tgcttatctt gaaatgccga tcgaagacaa cggaggagct gagtgatatc
      841 tatgcgttga atctttcgct atgcagcaac gtgcaggtga tcaaggagtg caacgggaac
      901 tttgtcgatg atccgcagaa gttaaatctg gaacaggtta aaatgcgtct caggaaaaca
      961 gtggaacgtc gccaggacta tctcaagtct cagaacgctg acgtgagctc agaagcacaa
     1021 gaactttatc gagcgatagc caaacaatac gggtacaatg aagtatcctg gcagggactg
     1081 aacatacaga tccttaacga agtcaccatc tcgccaccat atcgagtgga caacgtagta
     1141 tcgagttcaa acaacgaaac ttcgtgcaac tacattaagc gcatcatcaa acagttcttc
     1201 aactctcaga ctatcggggg cacaggatag tacttccaat gctgcggcca gcacttcgtc
     1261 agcgtcggtc tccccaacat cctcatctct gtcatcgagt aatgctgctt ctggttcgcc
     1321 ggttcccgct aactaaaaat aaaaaacaaa acaaacaaat agctt