Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361394 1325 bp mRNA linear INV 14-MAY-2021 factor 4H (LOC111070678), mRNA. ACCESSION XM_022361394 VERSION XM_022361394.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; corrected model. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361394.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## frameshifts :: corrected 1 indel ##RefSeq-Attributes-END## PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-106 JAECWW010000165.1 454148-454253 107-412 JAECWW010000165.1 455221-455526 413-662 JAECWW010000165.1 455635-455884 663-711 JAECWW010000165.1 455886-455934 712-1029 JAECWW010000165.1 456510-456827 1030-1325 JAECWW010000165.1 456902-457197 FEATURES Location/Qualifiers source 1..1325 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1325 /gene="LOC111070678" /note="The sequence of the model RefSeq transcript was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 91% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111070678" CDS 75..1196 /gene="LOC111070678" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon" /codon_start=1 /product="LOW QUALITY PROTEIN: eukaryotic translation initiation factor 4H" /protein_id="XP_022217086.2" /db_xref="GeneID:111070678" /translation="MAGRGGYEHARGGFGGERQMKVLPTEPPFIAFVGNLPQGLVQGD VMKIFQDFEVKNVRLVKDRETDMFKGFCYVEFETLENLERALEFDGRIKLDDLSAPLR IDIADRRKNDRPGGGGVGGGNGGMTRDGGRDGFQKRGPPRQGGTSQSYSRGGPGTGGN GGGGREGGGGSGNRADSRGSYNDNYGGHSDRSRGGGAGAGSGSGSGMNRGYNDRPANR GRYGNFNNDDRFERNQDRDRGQREGSYGNQSRDGDRYNNFSRHRDRERTHYNPNQQSE RPSGGLGGGGGGLGGSGGLGSSGNLGGGGGGGGGGGASIGAIDDTERPRLQLKPRTIA APINAVAETKQSASIFGNAKPREEKLKELEQNVSHNGDI" misc_feature 144..404 /gene="LOC111070678" /note="RNA recognition motif (RRM) found in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins; Region: RRM_eIF4H; cd12401" /db_xref="CDD:409835" ORIGIN 1 ggccgggcga caacttgggt tgtcaggtca atctgcggat tgcagcgaat tcgctcattt 61 gaaaaaaata aaacatggct ggaagaggtg gttatgaaca cgctaggggg ggatttggcg 121 gcgaacgcca gatgaaggta ctgccaacgg aaccgccctt tatcgccttt gtgggcaacc 181 tgccccaggg cctcgtccag ggcgatgtga tgaaaatatt tcaagacttt gaggtgaaga 241 acgtgaggct ggtaaaggat cgggaaacgg acatgttcaa aggcttttgc tacgtggaat 301 tcgaaacgct ggagaatctg gagcgggcac tcgagttcga tggacgcatc aaactggacg 361 atctgtcggc tccgctgcgc atcgatatag ctgaccggag gaaaaatgat cggcccggtg 421 gcggcggtgt tggcggtggc aatggaggca tgacccgtga tggtggaaga gacggtttcc 481 agaagcgtgg accgccccgt cagggcggta ccagccaatc ctatagccgg ggcggtcccg 541 gcactggcgg caacggcggc ggtggtcgcg agggtggcgg cggctctggt aatcgcgccg 601 atagtagagg ttcgtacaat gataattatg gtggtcacag tgatagaagt cgaggcggcg 661 gcgcgggcgc aggctccggc tccggcagtg gcatgaatag aggatacaat gatcggccgg 721 cgaatcgtgg tcggtacgga aactttaaca atgatgatcg gtttgagcgg aaccaggacc 781 gtgaccgggg gcagcgcgag ggcagttatg gcaaccagtc gcgcgacggc gaccgctaca 841 acaacttcag caggcaccgt gaccgcgagc gtacccacta caatcccaac cagcagagtg 901 aacgtcctag cggcggtctt ggtggaggcg gcggcggcct tgggggcagc ggcggtcttg 961 gcagcagcgg caacctcggt ggtggtggtg gcggcggagg cggtggtggt gcatcgattg 1021 gcgccattga cgacacggag aggccacgcc tgcagctgaa gccacggacc attgctgcgc 1081 caatcaatgc ggtggccgaa accaagcagt cggcatccat tttcggcaat gccaagccgc 1141 gcgaggagaa attgaaggag ctggagcaga atgtctctca caatggcgac atctaaagtg 1201 cagggaatcg atccgcaata aagcctgata tgatattttg ctggtgagag tgagacaggg 1261 agagagagag agagagaaaa agagggagag cgacagatga ggaagaagga gaagcgtcat 1321 gcgtc