Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura eukaryotic translation initiation


LOCUS       XM_022361394            1325 bp    mRNA    linear   INV 14-MAY-2021
            factor 4H (LOC111070678), mRNA.
ACCESSION   XM_022361394
VERSION     XM_022361394.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; corrected model.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361394.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            frameshifts :: corrected 1 indel
            ##RefSeq-Attributes-END##
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-106               JAECWW010000165.1  454148-454253
            107-412             JAECWW010000165.1  455221-455526
            413-662             JAECWW010000165.1  455635-455884
            663-711             JAECWW010000165.1  455886-455934
            712-1029            JAECWW010000165.1  456510-456827
            1030-1325           JAECWW010000165.1  456902-457197
FEATURES             Location/Qualifiers
     source          1..1325
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1325
                     /gene="LOC111070678"
                     /note="The sequence of the model RefSeq transcript was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon;
                     Derived by automated computational analysis using gene
                     prediction method: Gnomon. Supporting evidence includes
                     similarity to: 8 Proteins, and 91% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     17 samples with support for all annotated introns"
                     /db_xref="GeneID:111070678"
     CDS             75..1196
                     /gene="LOC111070678"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: deleted 1 base in 1 codon"
                     /codon_start=1
                     /product="LOW QUALITY PROTEIN: eukaryotic translation
                     initiation factor 4H"
                     /protein_id="XP_022217086.2"
                     /db_xref="GeneID:111070678"
                     /translation="MAGRGGYEHARGGFGGERQMKVLPTEPPFIAFVGNLPQGLVQGD
                     VMKIFQDFEVKNVRLVKDRETDMFKGFCYVEFETLENLERALEFDGRIKLDDLSAPLR
                     IDIADRRKNDRPGGGGVGGGNGGMTRDGGRDGFQKRGPPRQGGTSQSYSRGGPGTGGN
                     GGGGREGGGGSGNRADSRGSYNDNYGGHSDRSRGGGAGAGSGSGSGMNRGYNDRPANR
                     GRYGNFNNDDRFERNQDRDRGQREGSYGNQSRDGDRYNNFSRHRDRERTHYNPNQQSE
                     RPSGGLGGGGGGLGGSGGLGSSGNLGGGGGGGGGGGASIGAIDDTERPRLQLKPRTIA
                     APINAVAETKQSASIFGNAKPREEKLKELEQNVSHNGDI"
     misc_feature    144..404
                     /gene="LOC111070678"
                     /note="RNA recognition motif (RRM) found in eukaryotic
                     translation initiation factor 4H (eIF-4H) and similar
                     proteins; Region: RRM_eIF4H; cd12401"
                     /db_xref="CDD:409835"
ORIGIN      
        1 ggccgggcga caacttgggt tgtcaggtca atctgcggat tgcagcgaat tcgctcattt
       61 gaaaaaaata aaacatggct ggaagaggtg gttatgaaca cgctaggggg ggatttggcg
      121 gcgaacgcca gatgaaggta ctgccaacgg aaccgccctt tatcgccttt gtgggcaacc
      181 tgccccaggg cctcgtccag ggcgatgtga tgaaaatatt tcaagacttt gaggtgaaga
      241 acgtgaggct ggtaaaggat cgggaaacgg acatgttcaa aggcttttgc tacgtggaat
      301 tcgaaacgct ggagaatctg gagcgggcac tcgagttcga tggacgcatc aaactggacg
      361 atctgtcggc tccgctgcgc atcgatatag ctgaccggag gaaaaatgat cggcccggtg
      421 gcggcggtgt tggcggtggc aatggaggca tgacccgtga tggtggaaga gacggtttcc
      481 agaagcgtgg accgccccgt cagggcggta ccagccaatc ctatagccgg ggcggtcccg
      541 gcactggcgg caacggcggc ggtggtcgcg agggtggcgg cggctctggt aatcgcgccg
      601 atagtagagg ttcgtacaat gataattatg gtggtcacag tgatagaagt cgaggcggcg
      661 gcgcgggcgc aggctccggc tccggcagtg gcatgaatag aggatacaat gatcggccgg
      721 cgaatcgtgg tcggtacgga aactttaaca atgatgatcg gtttgagcgg aaccaggacc
      781 gtgaccgggg gcagcgcgag ggcagttatg gcaaccagtc gcgcgacggc gaccgctaca
      841 acaacttcag caggcaccgt gaccgcgagc gtacccacta caatcccaac cagcagagtg
      901 aacgtcctag cggcggtctt ggtggaggcg gcggcggcct tgggggcagc ggcggtcttg
      961 gcagcagcgg caacctcggt ggtggtggtg gcggcggagg cggtggtggt gcatcgattg
     1021 gcgccattga cgacacggag aggccacgcc tgcagctgaa gccacggacc attgctgcgc
     1081 caatcaatgc ggtggccgaa accaagcagt cggcatccat tttcggcaat gccaagccgc
     1141 gcgaggagaa attgaaggag ctggagcaga atgtctctca caatggcgac atctaaagtg
     1201 cagggaatcg atccgcaata aagcctgata tgatattttg ctggtgagag tgagacaggg
     1261 agagagagag agagagaaaa agagggagag cgacagatga ggaagaagga gaagcgtcat
     1321 gcgtc