Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022361372 1614 bp mRNA linear INV 14-MAY-2021 (LOC111070663), mRNA. ACCESSION XM_022361372 VERSION XM_022361372.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022361372.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1614 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1614 /gene="LOC111070663" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111070663" CDS 78..1493 /gene="LOC111070663" /codon_start=1 /product="pleiotropic regulator 1" /protein_id="XP_022217064.1" /db_xref="GeneID:111070663" /translation="MEDVQKHSVHTLIFRSLKRTHDLFVSNQGNLPDVDDRLDKQRRS IKAKDTYGSLMDRVVTANEPNRTPSGHSVERPLAITDGSTDTASSLMKFNADARRPDT VLSIPGNNSTSLVRASMPSNGPGSNGASNLQLIPKKAPTIPKPKWHAPWKLSRVISGH LGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYL FSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRT KANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRS VVLHPSLYMFASASPDNIKQWRCPEGNFVQNISGHTAIVNCMAANNDGVLVSGGDNGT MFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDHSGTRLITAEADKTIKVYKEDD EASEETHPVNWRPDLLKRRKF" misc_feature 534..1418 /gene="LOC111070663" /note="WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from...; Region: WD40; cd00200" /db_xref="CDD:238121" misc_feature order(555..557,609..611,621..623,639..644,678..683, 735..737,747..749,765..770,804..809,858..860,873..875, 891..896,933..935,984..986,999..1001,1017..1022, 1056..1061,1113..1115,1125..1127,1140..1145,1179..1184, 1230..1232,1245..1247,1263..1268,1302..1307,1383..1385, 1395..1397,1413..1418) /gene="LOC111070663" /note="structural tetrad [active]" /db_xref="CDD:238121" misc_feature 573..680 /gene="LOC111070663" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 696..806 /gene="LOC111070663" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 819..929 /gene="LOC111070663" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 948..1055 /gene="LOC111070663" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1071..1178 /gene="LOC111070663" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1200..1322 /gene="LOC111070663" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" misc_feature 1341..1415 /gene="LOC111070663" /note="WD40 repeat [structural motif]; Region: WD40 repeat" /db_xref="CDD:293791" ORIGIN 1 tgcagcccta gttgtgactg accggactgt tttgccgcat ttttgtttag tttatctcgg 61 atccatttaa ttgatcaatg gaggacgtac aaaagcacag cgtgcacacg cttatatttc 121 gctccctaaa gcgcacacac gatctgttcg tctccaatca aggaaacctg cccgatgtcg 181 acgaccgact ggacaaacaa cggcgatcga tcaaggccaa ggatacctat ggctcgttaa 241 tggacagggt tgtgacagcc aacgagccaa ataggactcc atcaggacac tccgtggaaa 301 ggccattggc catcacagac gggagcacag acactgccag cagcctgatg aaattcaatg 361 ccgatgcgcg tcgccccgac acggtgctgt ctataccggg taacaatagc acatccctag 421 tgcgggcatc catgcccagc aatggacctg gatctaatgg cgccagcaat ctgcagctca 481 ttccaaagaa ggcacccacc ataccgaagc ccaagtggca tgcaccctgg aagctgtctc 541 gcgtcatttc cggacatttg ggttgggtgc gttgcatagc cgtggagccg ggcaatgagt 601 ggttcgccac cggtgccggg gatcgtgtca ttaaaatctg ggatttggcc agcggtaagc 661 tgaaactctc gctcaccggg cacgtgagca ctgtacgggg agtggcagtc agcaccaagc 721 atccgtatct gttcagctgc ggcgaggatc gtcaggtgaa gtgctgggat ctggagtaca 781 acaaagtgat ccgacactat catggacatc tgtctgccgt ctactcgctg gccctccacc 841 caaccatcga tgtgttggcc acctctgggc gcgactccac ggctcgcatc tgggacatga 901 ggaccaaggc caatgtgcac acgctgaccg gccacaccaa tacggtggct agtgtggtgg 961 cccaggccac caatccacag atcatcaccg gctcccatga ttccaccgtg cggctgtggg 1021 atctagctgc cggcaagagc gtctgcaccc tgaccaacca taagaagtct gtgcgcagcg 1081 ttgtgctgca tccatcgctg tacatgttcg cctccgcctc gcccgacaac atcaaacagt 1141 ggcgctgtcc cgagggcaac tttgtgcaga acatctccgg ccacacggcc attgtcaact 1201 gtatggcggc caataacgat ggggtgctgg tctctggcgg cgacaacggc accatgttct 1261 tctgggactg gcgcaccggc tataatttcc agcgtttcca ggcccccgtc cagcccggct 1321 ccatggacag cgaggcgggc atatttgcca tgtgctttga ccattcgggc acgcgtctaa 1381 tcaccgccga ggcggacaag accatcaagg tgtacaagga ggatgacgaa gccagcgagg 1441 agacgcatcc agtcaattgg cggccagatc tgttgaagcg tcgcaagttc taagttctat 1501 ccggtagtct gtagtccaca aaaatatcta atgtataatt taagcgtaaa actgcccccg 1561 gaaacagatt tcgattaaat aatggtttgt tccaatgcaa ttctacatca aata