Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura pleiotropic regulator 1


LOCUS       XM_022361372            1614 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111070663), mRNA.
ACCESSION   XM_022361372
VERSION     XM_022361372.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022361372.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1614
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1614
                     /gene="LOC111070663"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 4 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111070663"
     CDS             78..1493
                     /gene="LOC111070663"
                     /codon_start=1
                     /product="pleiotropic regulator 1"
                     /protein_id="XP_022217064.1"
                     /db_xref="GeneID:111070663"
                     /translation="MEDVQKHSVHTLIFRSLKRTHDLFVSNQGNLPDVDDRLDKQRRS
                     IKAKDTYGSLMDRVVTANEPNRTPSGHSVERPLAITDGSTDTASSLMKFNADARRPDT
                     VLSIPGNNSTSLVRASMPSNGPGSNGASNLQLIPKKAPTIPKPKWHAPWKLSRVISGH
                     LGWVRCIAVEPGNEWFATGAGDRVIKIWDLASGKLKLSLTGHVSTVRGVAVSTKHPYL
                     FSCGEDRQVKCWDLEYNKVIRHYHGHLSAVYSLALHPTIDVLATSGRDSTARIWDMRT
                     KANVHTLTGHTNTVASVVAQATNPQIITGSHDSTVRLWDLAAGKSVCTLTNHKKSVRS
                     VVLHPSLYMFASASPDNIKQWRCPEGNFVQNISGHTAIVNCMAANNDGVLVSGGDNGT
                     MFFWDWRTGYNFQRFQAPVQPGSMDSEAGIFAMCFDHSGTRLITAEADKTIKVYKEDD
                     EASEETHPVNWRPDLLKRRKF"
     misc_feature    534..1418
                     /gene="LOC111070663"
                     /note="WD40 domain, found in a number of eukaryotic
                     proteins that cover a wide variety of functions including
                     adaptor/regulatory modules in signal transduction,
                     pre-mRNA processing and cytoskeleton assembly; typically
                     contains a GH dipeptide 11-24 residues from...; Region:
                     WD40; cd00200"
                     /db_xref="CDD:238121"
     misc_feature    order(555..557,609..611,621..623,639..644,678..683,
                     735..737,747..749,765..770,804..809,858..860,873..875,
                     891..896,933..935,984..986,999..1001,1017..1022,
                     1056..1061,1113..1115,1125..1127,1140..1145,1179..1184,
                     1230..1232,1245..1247,1263..1268,1302..1307,1383..1385,
                     1395..1397,1413..1418)
                     /gene="LOC111070663"
                     /note="structural tetrad [active]"
                     /db_xref="CDD:238121"
     misc_feature    573..680
                     /gene="LOC111070663"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    696..806
                     /gene="LOC111070663"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    819..929
                     /gene="LOC111070663"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    948..1055
                     /gene="LOC111070663"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1071..1178
                     /gene="LOC111070663"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1200..1322
                     /gene="LOC111070663"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
     misc_feature    1341..1415
                     /gene="LOC111070663"
                     /note="WD40 repeat [structural motif]; Region: WD40
                     repeat"
                     /db_xref="CDD:293791"
ORIGIN      
        1 tgcagcccta gttgtgactg accggactgt tttgccgcat ttttgtttag tttatctcgg
       61 atccatttaa ttgatcaatg gaggacgtac aaaagcacag cgtgcacacg cttatatttc
      121 gctccctaaa gcgcacacac gatctgttcg tctccaatca aggaaacctg cccgatgtcg
      181 acgaccgact ggacaaacaa cggcgatcga tcaaggccaa ggatacctat ggctcgttaa
      241 tggacagggt tgtgacagcc aacgagccaa ataggactcc atcaggacac tccgtggaaa
      301 ggccattggc catcacagac gggagcacag acactgccag cagcctgatg aaattcaatg
      361 ccgatgcgcg tcgccccgac acggtgctgt ctataccggg taacaatagc acatccctag
      421 tgcgggcatc catgcccagc aatggacctg gatctaatgg cgccagcaat ctgcagctca
      481 ttccaaagaa ggcacccacc ataccgaagc ccaagtggca tgcaccctgg aagctgtctc
      541 gcgtcatttc cggacatttg ggttgggtgc gttgcatagc cgtggagccg ggcaatgagt
      601 ggttcgccac cggtgccggg gatcgtgtca ttaaaatctg ggatttggcc agcggtaagc
      661 tgaaactctc gctcaccggg cacgtgagca ctgtacgggg agtggcagtc agcaccaagc
      721 atccgtatct gttcagctgc ggcgaggatc gtcaggtgaa gtgctgggat ctggagtaca
      781 acaaagtgat ccgacactat catggacatc tgtctgccgt ctactcgctg gccctccacc
      841 caaccatcga tgtgttggcc acctctgggc gcgactccac ggctcgcatc tgggacatga
      901 ggaccaaggc caatgtgcac acgctgaccg gccacaccaa tacggtggct agtgtggtgg
      961 cccaggccac caatccacag atcatcaccg gctcccatga ttccaccgtg cggctgtggg
     1021 atctagctgc cggcaagagc gtctgcaccc tgaccaacca taagaagtct gtgcgcagcg
     1081 ttgtgctgca tccatcgctg tacatgttcg cctccgcctc gcccgacaac atcaaacagt
     1141 ggcgctgtcc cgagggcaac tttgtgcaga acatctccgg ccacacggcc attgtcaact
     1201 gtatggcggc caataacgat ggggtgctgg tctctggcgg cgacaacggc accatgttct
     1261 tctgggactg gcgcaccggc tataatttcc agcgtttcca ggcccccgtc cagcccggct
     1321 ccatggacag cgaggcgggc atatttgcca tgtgctttga ccattcgggc acgcgtctaa
     1381 tcaccgccga ggcggacaag accatcaagg tgtacaagga ggatgacgaa gccagcgagg
     1441 agacgcatcc agtcaattgg cggccagatc tgttgaagcg tcgcaagttc taagttctat
     1501 ccggtagtct gtagtccaca aaaatatcta atgtataatt taagcgtaaa actgcccccg
     1561 gaaacagatt tcgattaaat aatggtttgt tccaatgcaa ttctacatca aata