Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354930 1341 bp mRNA linear INV 14-MAY-2021 PSF3 (LOC111066375), mRNA. ACCESSION XM_022354930 VERSION XM_022354930.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354930.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1341 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1341 /gene="LOC111066375" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 2 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111066375" CDS 92..718 /gene="LOC111066375" /codon_start=1 /product="DNA replication complex GINS protein PSF3" /protein_id="XP_022210622.2" /db_xref="GeneID:111066375" /translation="MNYFPNYFSIEDIFVTQEKVECKVNTKLQRMGFLDAGAEGDDLD PGRTINLPLWYIKELKVNNAYFTVAVPDIYKNVHKAVCEAETTHIELGRLHPYFYEFG RYLTPYDRNHVIGRIIFETMRQRVRHLLDISKNDGQLAKSELRLDNIEAKLHEAGVRT NTQYINWLQMTGNKILISELVEEHQKKRKRDRSDDEGDSLPSSKRATL" misc_feature 110..304 /gene="LOC111066375" /note="beta-strand (B) domain of GINS complex protein Psf3; Region: GINS_B_Psf3; cd21693" /db_xref="CDD:412029" misc_feature order(110..115,119..121,125..133,137..142,173..184, 251..256,263..268,284..286) /gene="LOC111066375" /note="tetramer interface [polypeptide binding]; other site" /db_xref="CDD:412029" misc_feature 284..601 /gene="LOC111066375" /note="Alpha-helical domain of GINS complex protein Psf3 (partner of Sld5 3); Region: GINS_A_psf3; cd11713" /db_xref="CDD:212551" misc_feature order(389..391,398..400,455..457,467..469,479..484, 527..529,536..538,542..544,548..580) /gene="LOC111066375" /note="tetramer interface [polypeptide binding]; other site" /db_xref="CDD:212551" ORIGIN 1 tgtattttgc tgtgcagccc tggttaccgc gcaaactgag tttctctttt gttttgatta 61 tttgtaatat taaaaccaga gccagagcgc aatgaactat tttccaaact acttttcgat 121 cgaggatata tttgtgaccc aggagaaggt cgaatgcaag gtcaacacga agctgcagcg 181 gatgggcttc ttggatgccg gcgccgaagg tgacgacctg gatccgggac gcaccatcaa 241 tctgccgctg tggtatatca aggaactgaa ggtgaacaat gcctacttca ccgtcgccgt 301 gcccgatatc tataagaatg tgcacaaggc cgtctgtgag gcggagacaa cgcacatcga 361 actgggtcga ctgcatccgt acttttacga gtttggccgc tatctgacgc cctatgaccg 421 caaccatgtc atcggtcgca tcatctttga gacgatgcgg cagcgtgtgc gtcatctgct 481 ggacatatcc aaaaacgatg gacaactggc caagtctgag ctgcgactgg acaacatcga 541 ggcaaagctg catgaggcgg gcgtgcgcac caatacccag tacatcaact ggctgcaaat 601 gacgggcaat aaaattctca tctcggagct ggtggaggag catcagaaga agcgaaaacg 661 tgaccgcagc gacgatgagg gggacagttt gcccagcagt aaacgtgcca ccctgtgaca 721 caccctacca cacccatccc cgaataatta ataattttgg ttctattttt ttttttttgt 781 ttgttgaaac atttagcaat tttattctgt aactcgctgc acgctgccca gatcagattc 841 tatgccatac cttgtaaata cccatgcaac actccacaca cacacacagg cacaaacaca 901 tatatgtata tgatgtttca tttcatgcca caaaaataca atacaatcgg tctacagatg 961 gtagcttcca aatacataca gatctatacg cggaatacat atctatgtgt gtatatatat 1021 attatatgta tatatgtcat tattgcatgt ctgtatagcg acagcaggga ttaagttttt 1081 cttgtttagt tgttgtaaat acataatagc taagcatttc tgacaggaca gaagcacaat 1141 gcacacacgg ttaggtacca aatctataaa ctcttactgc tgctgctgct gctgctccac 1201 tctctctctc tctctctctg gctatatatt tgctctccct catgcgttgg caataagcca 1261 acggaacaac catcgatcgt cttcaaacca tgcatgcaca catatattgt atatatgtag 1321 atataaatag gtaactacat a