Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura DNA replication complex GINS protein


LOCUS       XM_022354930            1341 bp    mRNA    linear   INV 14-MAY-2021
            PSF3 (LOC111066375), mRNA.
ACCESSION   XM_022354930
VERSION     XM_022354930.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354930.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1341
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1341
                     /gene="LOC111066375"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 2 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066375"
     CDS             92..718
                     /gene="LOC111066375"
                     /codon_start=1
                     /product="DNA replication complex GINS protein PSF3"
                     /protein_id="XP_022210622.2"
                     /db_xref="GeneID:111066375"
                     /translation="MNYFPNYFSIEDIFVTQEKVECKVNTKLQRMGFLDAGAEGDDLD
                     PGRTINLPLWYIKELKVNNAYFTVAVPDIYKNVHKAVCEAETTHIELGRLHPYFYEFG
                     RYLTPYDRNHVIGRIIFETMRQRVRHLLDISKNDGQLAKSELRLDNIEAKLHEAGVRT
                     NTQYINWLQMTGNKILISELVEEHQKKRKRDRSDDEGDSLPSSKRATL"
     misc_feature    110..304
                     /gene="LOC111066375"
                     /note="beta-strand (B) domain of GINS complex protein
                     Psf3; Region: GINS_B_Psf3; cd21693"
                     /db_xref="CDD:412029"
     misc_feature    order(110..115,119..121,125..133,137..142,173..184,
                     251..256,263..268,284..286)
                     /gene="LOC111066375"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:412029"
     misc_feature    284..601
                     /gene="LOC111066375"
                     /note="Alpha-helical domain of GINS complex protein Psf3
                     (partner of Sld5 3); Region: GINS_A_psf3; cd11713"
                     /db_xref="CDD:212551"
     misc_feature    order(389..391,398..400,455..457,467..469,479..484,
                     527..529,536..538,542..544,548..580)
                     /gene="LOC111066375"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212551"
ORIGIN      
        1 tgtattttgc tgtgcagccc tggttaccgc gcaaactgag tttctctttt gttttgatta
       61 tttgtaatat taaaaccaga gccagagcgc aatgaactat tttccaaact acttttcgat
      121 cgaggatata tttgtgaccc aggagaaggt cgaatgcaag gtcaacacga agctgcagcg
      181 gatgggcttc ttggatgccg gcgccgaagg tgacgacctg gatccgggac gcaccatcaa
      241 tctgccgctg tggtatatca aggaactgaa ggtgaacaat gcctacttca ccgtcgccgt
      301 gcccgatatc tataagaatg tgcacaaggc cgtctgtgag gcggagacaa cgcacatcga
      361 actgggtcga ctgcatccgt acttttacga gtttggccgc tatctgacgc cctatgaccg
      421 caaccatgtc atcggtcgca tcatctttga gacgatgcgg cagcgtgtgc gtcatctgct
      481 ggacatatcc aaaaacgatg gacaactggc caagtctgag ctgcgactgg acaacatcga
      541 ggcaaagctg catgaggcgg gcgtgcgcac caatacccag tacatcaact ggctgcaaat
      601 gacgggcaat aaaattctca tctcggagct ggtggaggag catcagaaga agcgaaaacg
      661 tgaccgcagc gacgatgagg gggacagttt gcccagcagt aaacgtgcca ccctgtgaca
      721 caccctacca cacccatccc cgaataatta ataattttgg ttctattttt ttttttttgt
      781 ttgttgaaac atttagcaat tttattctgt aactcgctgc acgctgccca gatcagattc
      841 tatgccatac cttgtaaata cccatgcaac actccacaca cacacacagg cacaaacaca
      901 tatatgtata tgatgtttca tttcatgcca caaaaataca atacaatcgg tctacagatg
      961 gtagcttcca aatacataca gatctatacg cggaatacat atctatgtgt gtatatatat
     1021 attatatgta tatatgtcat tattgcatgt ctgtatagcg acagcaggga ttaagttttt
     1081 cttgtttagt tgttgtaaat acataatagc taagcatttc tgacaggaca gaagcacaat
     1141 gcacacacgg ttaggtacca aatctataaa ctcttactgc tgctgctgct gctgctccac
     1201 tctctctctc tctctctctg gctatatatt tgctctccct catgcgttgg caataagcca
     1261 acggaacaac catcgatcgt cttcaaacca tgcatgcaca catatattgt atatatgtag
     1321 atataaatag gtaactacat a