Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura thymosin beta (LOC111066373), mRNA.


LOCUS       XM_022354928            1042 bp    mRNA    linear   INV 14-MAY-2021
ACCESSION   XM_022354928
VERSION     XM_022354928.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354928.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1042
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1042
                     /gene="LOC111066373"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 16 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066373"
     CDS             216..605
                     /gene="LOC111066373"
                     /codon_start=1
                     /product="thymosin beta"
                     /protein_id="XP_022210620.1"
                     /db_xref="GeneID:111066373"
                     /translation="MASTAPALKDLPKVAENLKSQLEGFNTEKLKNASTQEKIILPTA
                     EDVAAEKTQQSIIESITGFDQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFD
                     AKKLKHTETNEKNVLPTKEVIEAEKKA"
     misc_feature    243..374
                     /gene="LOC111066373"
                     /note="Thymosin beta-4 family; Region: Thymosin;
                     pfam01290"
                     /db_xref="CDD:396038"
     misc_feature    393..482
                     /gene="LOC111066373"
                     /note="Thymosin beta-4 family; Region: Thymosin;
                     pfam01290"
                     /db_xref="CDD:396038"
     misc_feature    507..602
                     /gene="LOC111066373"
                     /note="Thymosin beta-4 family; Region: Thymosin;
                     pfam01290"
                     /db_xref="CDD:396038"
ORIGIN      
        1 gtttcgacgt ccatccaatc cagttagctt gtgcgctccg cgaacgaatt gaaagaaaga
       61 gtattactta aatcaagtgt aaagaaatta catagtgtat accgcttata tataaaaata
      121 tatatagcag tcccaaccaa ccccggccag ccagctacac cccagcagta tctttttttt
      181 gtaaatccaa accaaaaaaa aaacaaaaac ttaagatggc atccacagcc ccagcactaa
      241 aggatctgcc caaggtggcc gagaacttga agagccaatt ggagggcttc aacacggaga
      301 aactgaagaa tgccagcacc caggagaaga tcattttgcc cacagccgag gatgtggctg
      361 ccgagaagac ccaacaatca atcattgaga gcatcactgg attcgatcag aacaacttga
      421 agcacaccga gaccaacgag aagaacccct tgcccgataa ggaagccatt gaacaggaga
      481 aggagaagaa tcaattcata gccggcatcg agaatttcga tgcgaaaaag ttgaagcaca
      541 ccgagaccaa cgagaagaac gtgctgccca ccaaggaggt catcgaggcc gagaagaagg
      601 cctaagccaa aatggcaggc gcatccagca ttgccaataa acgttgcatc tctctcaagc
      661 acatacaaaa aacacaaaca aacacacaca cacattttct atacgcgtat atatcttttt
      721 ccttttccat ttgctaaaac catcaaaacg aacattcagg ctaacgtaca taagagtaat
      781 agaaggagaa ccatgccaag cacagactct caagcagcct cagagtcgcc gccatccatc
      841 agaaaagctt cacttcacaa taacttgaac aattaccgga atggcattgc cagtcattgc
      901 aacgatgctg ctgctgctgc tggtggtggt ggtggtgggg ggggagatac agagagagag
      961 agatcttgca acacagatcg tgagactgtt gctgtttgta ccacacatcc taactaactt
     1021 attgtctgcc tgcttgaaaa ag