Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354928 1042 bp mRNA linear INV 14-MAY-2021 ACCESSION XM_022354928 VERSION XM_022354928.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354928.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1042 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1042 /gene="LOC111066373" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 16 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 17 samples with support for all annotated introns" /db_xref="GeneID:111066373" CDS 216..605 /gene="LOC111066373" /codon_start=1 /product="thymosin beta" /protein_id="XP_022210620.1" /db_xref="GeneID:111066373" /translation="MASTAPALKDLPKVAENLKSQLEGFNTEKLKNASTQEKIILPTA EDVAAEKTQQSIIESITGFDQNNLKHTETNEKNPLPDKEAIEQEKEKNQFIAGIENFD AKKLKHTETNEKNVLPTKEVIEAEKKA" misc_feature 243..374 /gene="LOC111066373" /note="Thymosin beta-4 family; Region: Thymosin; pfam01290" /db_xref="CDD:396038" misc_feature 393..482 /gene="LOC111066373" /note="Thymosin beta-4 family; Region: Thymosin; pfam01290" /db_xref="CDD:396038" misc_feature 507..602 /gene="LOC111066373" /note="Thymosin beta-4 family; Region: Thymosin; pfam01290" /db_xref="CDD:396038" ORIGIN 1 gtttcgacgt ccatccaatc cagttagctt gtgcgctccg cgaacgaatt gaaagaaaga 61 gtattactta aatcaagtgt aaagaaatta catagtgtat accgcttata tataaaaata 121 tatatagcag tcccaaccaa ccccggccag ccagctacac cccagcagta tctttttttt 181 gtaaatccaa accaaaaaaa aaacaaaaac ttaagatggc atccacagcc ccagcactaa 241 aggatctgcc caaggtggcc gagaacttga agagccaatt ggagggcttc aacacggaga 301 aactgaagaa tgccagcacc caggagaaga tcattttgcc cacagccgag gatgtggctg 361 ccgagaagac ccaacaatca atcattgaga gcatcactgg attcgatcag aacaacttga 421 agcacaccga gaccaacgag aagaacccct tgcccgataa ggaagccatt gaacaggaga 481 aggagaagaa tcaattcata gccggcatcg agaatttcga tgcgaaaaag ttgaagcaca 541 ccgagaccaa cgagaagaac gtgctgccca ccaaggaggt catcgaggcc gagaagaagg 601 cctaagccaa aatggcaggc gcatccagca ttgccaataa acgttgcatc tctctcaagc 661 acatacaaaa aacacaaaca aacacacaca cacattttct atacgcgtat atatcttttt 721 ccttttccat ttgctaaaac catcaaaacg aacattcagg ctaacgtaca taagagtaat 781 agaaggagaa ccatgccaag cacagactct caagcagcct cagagtcgcc gccatccatc 841 agaaaagctt cacttcacaa taacttgaac aattaccgga atggcattgc cagtcattgc 901 aacgatgctg ctgctgctgc tggtggtggt ggtggtgggg ggggagatac agagagagag 961 agatcttgca acacagatcg tgagactgtt gctgtttgta ccacacatcc taactaactt 1021 attgtctgcc tgcttgaaaa ag