Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354914 1096 bp mRNA linear INV 14-MAY-2021 (LOC111066366), transcript variant X2, mRNA. ACCESSION XM_022354914 VERSION XM_022354914.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354914.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1096 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1096 /gene="LOC111066366" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:111066366" CDS 144..1028 /gene="LOC111066366" /codon_start=1 /product="uncharacterized protein LOC111066366" /protein_id="XP_022210606.2" /db_xref="GeneID:111066366" /translation="MSGKDLYAVAYEAKLHDEIVNRSGQVIRERVVMPDEMKQDIGGA DKKDMKIPQINANKYKDDPENYMEMRAKYMKKEMKAATENQDMAMHERVMNMDVVKPS AGVEPDEETSEHNRQTNADLDPELTERDMLVRRGRIAVLELINENEVNLHYAPFFLQK LVEQAKETTPDHAQYFLRQIIDEQKQHLDHADEDSLKELIKMIIPMDKKSVTKKWIKE YKENNPLTILTDYDLEDLANEKSIFQEMTSEQMQQYNAEQSQRLEMNIFLYNGLVNGL LLAFGCLMLSSTLDFMFG" ORIGIN 1 tgagttttca gttgcgatgc ttttttagtt caattcaaaa ttatcataaa ttgggaaaca 61 gatgtattga aaatattcga accacctctt gaagcacctc ctagggaaag tataaacagt 121 aatctcaaac gctttgccct ccaatgagtg gaaaagattt gtatgctgtg gcttatgaag 181 caaaactcca tgatgaaatt gtcaaccgca gtgggcaggt aattcgggaa agggtggtga 241 tgccggatga aatgaaacag gacattggtg gggcagacaa aaaagacatg aaaattccac 301 aaataaatgc aaacaagtac aaagatgatc cggaaaatta catggaaatg cgtgcaaaat 361 acatgaaaaa ggaaatgaaa gcagccaccg agaatcaaga catggcaatg catgagagag 421 taatgaatat ggatgtggta aagccctcgg caggagtaga acccgatgaa gaaacgtccg 481 agcacaatag gcagacgaat gcagacctcg atccggagct gactgaaagg gatatgttgg 541 ttcgtagagg caggatcgcc gtactggaat tgatcaacga aaatgaagtg aatttgcatt 601 atgcaccgtt tttcctacaa aaactggtcg aacaggcaaa ggaaacaact ccggatcatg 661 cacaatattt cctgcggcag attatcgatg agcaaaagca gcacttggac cacgctgatg 721 aggattcgct caaagaacta atcaagatga tcataccaat ggacaagaag agcgtcacca 781 aaaagtggat caaagagtac aaggaaaata atccgttgac cattttgacc gattacgatt 841 tggaggattt ggccaatgaa aaatcgattt tccaggagat gacatccgaa cagatgcagc 901 aatacaatgc cgagcagagt caaagactgg aaatgaacat attcctgtat aacggcttgg 961 tcaatggtct tctgttggca tttggctgcc tcatgttgag cagcacgcta gattttatgt 1021 ttggctaaca tccccacatg cagcaaacca tctggcagac aaaacagaat tacatagaaa 1081 tgcatacgat agctgg