Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066366


LOCUS       XM_022354914            1096 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066366), transcript variant X2, mRNA.
ACCESSION   XM_022354914
VERSION     XM_022354914.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354914.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1096
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1096
                     /gene="LOC111066366"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 7 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111066366"
     CDS             144..1028
                     /gene="LOC111066366"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066366"
                     /protein_id="XP_022210606.2"
                     /db_xref="GeneID:111066366"
                     /translation="MSGKDLYAVAYEAKLHDEIVNRSGQVIRERVVMPDEMKQDIGGA
                     DKKDMKIPQINANKYKDDPENYMEMRAKYMKKEMKAATENQDMAMHERVMNMDVVKPS
                     AGVEPDEETSEHNRQTNADLDPELTERDMLVRRGRIAVLELINENEVNLHYAPFFLQK
                     LVEQAKETTPDHAQYFLRQIIDEQKQHLDHADEDSLKELIKMIIPMDKKSVTKKWIKE
                     YKENNPLTILTDYDLEDLANEKSIFQEMTSEQMQQYNAEQSQRLEMNIFLYNGLVNGL
                     LLAFGCLMLSSTLDFMFG"
ORIGIN      
        1 tgagttttca gttgcgatgc ttttttagtt caattcaaaa ttatcataaa ttgggaaaca
       61 gatgtattga aaatattcga accacctctt gaagcacctc ctagggaaag tataaacagt
      121 aatctcaaac gctttgccct ccaatgagtg gaaaagattt gtatgctgtg gcttatgaag
      181 caaaactcca tgatgaaatt gtcaaccgca gtgggcaggt aattcgggaa agggtggtga
      241 tgccggatga aatgaaacag gacattggtg gggcagacaa aaaagacatg aaaattccac
      301 aaataaatgc aaacaagtac aaagatgatc cggaaaatta catggaaatg cgtgcaaaat
      361 acatgaaaaa ggaaatgaaa gcagccaccg agaatcaaga catggcaatg catgagagag
      421 taatgaatat ggatgtggta aagccctcgg caggagtaga acccgatgaa gaaacgtccg
      481 agcacaatag gcagacgaat gcagacctcg atccggagct gactgaaagg gatatgttgg
      541 ttcgtagagg caggatcgcc gtactggaat tgatcaacga aaatgaagtg aatttgcatt
      601 atgcaccgtt tttcctacaa aaactggtcg aacaggcaaa ggaaacaact ccggatcatg
      661 cacaatattt cctgcggcag attatcgatg agcaaaagca gcacttggac cacgctgatg
      721 aggattcgct caaagaacta atcaagatga tcataccaat ggacaagaag agcgtcacca
      781 aaaagtggat caaagagtac aaggaaaata atccgttgac cattttgacc gattacgatt
      841 tggaggattt ggccaatgaa aaatcgattt tccaggagat gacatccgaa cagatgcagc
      901 aatacaatgc cgagcagagt caaagactgg aaatgaacat attcctgtat aacggcttgg
      961 tcaatggtct tctgttggca tttggctgcc tcatgttgag cagcacgcta gattttatgt
     1021 ttggctaaca tccccacatg cagcaaacca tctggcagac aaaacagaat tacatagaaa
     1081 tgcatacgat agctgg