Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354912 1118 bp mRNA linear INV 14-MAY-2021 (LOC111066366), transcript variant X1, mRNA. ACCESSION XM_022354912 VERSION XM_022354912.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354912.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..1118 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..1118 /gene="LOC111066366" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:111066366" CDS 166..1050 /gene="LOC111066366" /codon_start=1 /product="uncharacterized protein LOC111066366" /protein_id="XP_022210604.2" /db_xref="GeneID:111066366" /translation="MSGKDLYAVAYEAKLHDEIVNRSGQVIRERVVMPDEMKQDIGGA DKKDMKIPQINANKYKDDPENYMEMRAKYMKKEMKAATENQDMAMHERVMNMDVVKPS AGVEPDEETSEHNRQTNADLDPELTERDMLVRRGRIAVLELINENEVNLHYAPFFLQK LVEQAKETTPDHAQYFLRQIIDEQKQHLDHADEDSLKELIKMIIPMDKKSVTKKWIKE YKENNPLTILTDYDLEDLANEKSIFQEMTSEQMQQYNAEQSQRLEMNIFLYNGLVNGL LLAFGCLMLSSTLDFMFG" ORIGIN 1 tgagttttca gttgcgatgc ttttttagtt caattcaaaa ttatcataaa ttgggaaaca 61 gatgtattga aaatattcga accacctctt gaagcacctc ctagggaaag tataaacagt 121 tctattcgtt cactcaagta gtaatctcaa acgctttgcc ctccaatgag tggaaaagat 181 ttgtatgctg tggcttatga agcaaaactc catgatgaaa ttgtcaaccg cagtgggcag 241 gtaattcggg aaagggtggt gatgccggat gaaatgaaac aggacattgg tggggcagac 301 aaaaaagaca tgaaaattcc acaaataaat gcaaacaagt acaaagatga tccggaaaat 361 tacatggaaa tgcgtgcaaa atacatgaaa aaggaaatga aagcagccac cgagaatcaa 421 gacatggcaa tgcatgagag agtaatgaat atggatgtgg taaagccctc ggcaggagta 481 gaacccgatg aagaaacgtc cgagcacaat aggcagacga atgcagacct cgatccggag 541 ctgactgaaa gggatatgtt ggttcgtaga ggcaggatcg ccgtactgga attgatcaac 601 gaaaatgaag tgaatttgca ttatgcaccg tttttcctac aaaaactggt cgaacaggca 661 aaggaaacaa ctccggatca tgcacaatat ttcctgcggc agattatcga tgagcaaaag 721 cagcacttgg accacgctga tgaggattcg ctcaaagaac taatcaagat gatcatacca 781 atggacaaga agagcgtcac caaaaagtgg atcaaagagt acaaggaaaa taatccgttg 841 accattttga ccgattacga tttggaggat ttggccaatg aaaaatcgat tttccaggag 901 atgacatccg aacagatgca gcaatacaat gccgagcaga gtcaaagact ggaaatgaac 961 atattcctgt ataacggctt ggtcaatggt cttctgttgg catttggctg cctcatgttg 1021 agcagcacgc tagattttat gtttggctaa catccccaca tgcagcaaac catctggcag 1081 acaaaacaga attacataga aatgcatacg atagctgg