Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066366


LOCUS       XM_022354912            1118 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066366), transcript variant X1, mRNA.
ACCESSION   XM_022354912
VERSION     XM_022354912.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354912.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1118
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1118
                     /gene="LOC111066366"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111066366"
     CDS             166..1050
                     /gene="LOC111066366"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066366"
                     /protein_id="XP_022210604.2"
                     /db_xref="GeneID:111066366"
                     /translation="MSGKDLYAVAYEAKLHDEIVNRSGQVIRERVVMPDEMKQDIGGA
                     DKKDMKIPQINANKYKDDPENYMEMRAKYMKKEMKAATENQDMAMHERVMNMDVVKPS
                     AGVEPDEETSEHNRQTNADLDPELTERDMLVRRGRIAVLELINENEVNLHYAPFFLQK
                     LVEQAKETTPDHAQYFLRQIIDEQKQHLDHADEDSLKELIKMIIPMDKKSVTKKWIKE
                     YKENNPLTILTDYDLEDLANEKSIFQEMTSEQMQQYNAEQSQRLEMNIFLYNGLVNGL
                     LLAFGCLMLSSTLDFMFG"
ORIGIN      
        1 tgagttttca gttgcgatgc ttttttagtt caattcaaaa ttatcataaa ttgggaaaca
       61 gatgtattga aaatattcga accacctctt gaagcacctc ctagggaaag tataaacagt
      121 tctattcgtt cactcaagta gtaatctcaa acgctttgcc ctccaatgag tggaaaagat
      181 ttgtatgctg tggcttatga agcaaaactc catgatgaaa ttgtcaaccg cagtgggcag
      241 gtaattcggg aaagggtggt gatgccggat gaaatgaaac aggacattgg tggggcagac
      301 aaaaaagaca tgaaaattcc acaaataaat gcaaacaagt acaaagatga tccggaaaat
      361 tacatggaaa tgcgtgcaaa atacatgaaa aaggaaatga aagcagccac cgagaatcaa
      421 gacatggcaa tgcatgagag agtaatgaat atggatgtgg taaagccctc ggcaggagta
      481 gaacccgatg aagaaacgtc cgagcacaat aggcagacga atgcagacct cgatccggag
      541 ctgactgaaa gggatatgtt ggttcgtaga ggcaggatcg ccgtactgga attgatcaac
      601 gaaaatgaag tgaatttgca ttatgcaccg tttttcctac aaaaactggt cgaacaggca
      661 aaggaaacaa ctccggatca tgcacaatat ttcctgcggc agattatcga tgagcaaaag
      721 cagcacttgg accacgctga tgaggattcg ctcaaagaac taatcaagat gatcatacca
      781 atggacaaga agagcgtcac caaaaagtgg atcaaagagt acaaggaaaa taatccgttg
      841 accattttga ccgattacga tttggaggat ttggccaatg aaaaatcgat tttccaggag
      901 atgacatccg aacagatgca gcaatacaat gccgagcaga gtcaaagact ggaaatgaac
      961 atattcctgt ataacggctt ggtcaatggt cttctgttgg catttggctg cctcatgttg
     1021 agcagcacgc tagattttat gtttggctaa catccccaca tgcagcaaac catctggcag
     1081 acaaaacaga attacataga aatgcatacg atagctgg