Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354900 642 bp mRNA linear INV 14-MAY-2021 (LOC111066360), mRNA. ACCESSION XM_022354900 VERSION XM_022354900.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq; includes ab initio. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354900.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## ab initio :: 100% of CDS bases ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..642 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..642 /gene="LOC111066360" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 103 Proteins" /db_xref="GeneID:111066360" CDS 1..642 /gene="LOC111066360" /codon_start=1 /product="ras-related protein ORAB-1" /protein_id="XP_022210592.2" /db_xref="GeneID:111066360" /translation="MHFKILLLGDSGVGKTSLLQRFMGGRFTARYHSSVGVELGIHYI EVAGQVVQLLIWDAAGEKRFRPLFPSYYREVHGIMLVYDTTKPSSFRSLPCWLDEIKM FSQRDVCIVLVGNKCENLKCRKISQLQGLTFADGKGLAFCEASARSGVNVDQIFATLS LKIHETYQAQYSDIYTVRLKSPKPKLESPLKDTGSFRLVASPGPKNSKKFCCW" misc_feature 7..498 /gene="LOC111066360" /note="Members of the P-loop NTPase domain superfamily are characterized by a conserved nucleotide phosphate-binding motif, also referred to as the Walker A motif (GxxxxGK[S/T], where x is any residue), and the Walker B motif (hhhh[D/E], where h is a...; Region: P-loop containing Nucleoside Triphosphate Hydrolases; cl38936" /db_xref="CDD:476819" misc_feature 7..12 /gene="LOC111066360" /note="Rab subfamily motif 1 (RabSF1); other site" /db_xref="CDD:206640" misc_feature 25..48 /gene="LOC111066360" /note="G1 box; other site" /db_xref="CDD:206640" misc_feature order(31..51,79..81,100..102,178..180,343..348,352..354, 433..441) /gene="LOC111066360" /note="GTP/Mg2+ binding site [chemical binding]; other site" /db_xref="CDD:206640" misc_feature 49..81 /gene="LOC111066360" /note="Rab subfamily motif 2 (RabSF2); other site" /db_xref="CDD:206640" misc_feature order(79..81,100..120) /gene="LOC111066360" /note="Switch I region; other site" /db_xref="CDD:206640" misc_feature 100..102 /gene="LOC111066360" /note="G2 box; other site" /db_xref="CDD:206640" misc_feature order(103..105,109..117,160..162,166..168,187..192, 199..201,211..213,226..228) /gene="LOC111066360" /note="effector interaction site [active]" /db_xref="CDD:206640" misc_feature order(103..108,112..114,166..171,190..192,202..210) /gene="LOC111066360" /note="GDI interaction site [active]" /db_xref="CDD:206640" misc_feature 103..117 /gene="LOC111066360" /note="Rab family motif 1 (RabF1); other site" /db_xref="CDD:206640" misc_feature order(106..129,148..150,154..156) /gene="LOC111066360" /note="GEF interaction site [polypeptide binding]; other site" /db_xref="CDD:206640" misc_feature 154..168 /gene="LOC111066360" /note="Rab family motif 2 (RabF2); other site" /db_xref="CDD:206640" misc_feature 169..180 /gene="LOC111066360" /note="G3 box; other site" /db_xref="CDD:206640" misc_feature order(178..180,184..195,199..216) /gene="LOC111066360" /note="Switch II region; other site" /db_xref="CDD:206640" misc_feature order(187..195,199..204) /gene="LOC111066360" /note="Rab family motif 3 (RabF3); other site" /db_xref="CDD:206640" misc_feature 211..216 /gene="LOC111066360" /note="Rab family motif 4 (RabF4); other site" /db_xref="CDD:206640" misc_feature 238..255 /gene="LOC111066360" /note="Rab family motif 5 (RabF5); other site" /db_xref="CDD:206640" misc_feature 322..336 /gene="LOC111066360" /note="Rab subfamily motif 3 (RabSF3); other site" /db_xref="CDD:206640" misc_feature 343..354 /gene="LOC111066360" /note="G4 box; other site" /db_xref="CDD:206640" misc_feature 433..441 /gene="LOC111066360" /note="G5 box; other site" /db_xref="CDD:206640" ORIGIN 1 atgcacttca agatactgtt gttgggcgat tctggcgtgg gcaaaaccag tctgctgcag 61 cgcttcatgg gcggacgttt cacggcccgg taccacagct ccgtgggtgt ggagctgggt 121 atacactaca ttgaggtggc cggacaggtg gtgcagctac tcatctggga tgcggccggc 181 gagaagcgtt ttcgtcccct gtttcccagc tactatcgtg aagtgcacgg cattatgctg 241 gtctacgaca ccacaaaacc atccagtttc aggagcttgc cgtgctggct ggatgagatc 301 aaaatgttca gccagcggga cgtgtgcatt gtcctggtgg gcaacaagtg cgaaaatctg 361 aaatgccgca agatcagcca actgcaggga ctcacctttg ccgacggcaa gggactcgcc 421 ttctgtgagg catccgccag gagcggggtc aatgttgacc aaatctttgc cactctctcg 481 ctcaagatac acgaaaccta tcaggcgcaa tactctgaca tctacactgt tcgcctgaag 541 tcgcccaagc ctaagctgga atccccactg aaggacactg gcagtttccg cttggttgct 601 tcgccgggcc caaagaatag caaaaaattt tgttgttggt ga