Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura ATP synthase membrane subunit K,


LOCUS       XM_022354897             396 bp    mRNA    linear   INV 14-MAY-2021
            mitochondrial (LOC111066357), mRNA.
ACCESSION   XM_022354897
VERSION     XM_022354897.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354897.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..396
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..396
                     /gene="LOC111066357"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 17 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066357"
     CDS             66..212
                     /gene="LOC111066357"
                     /codon_start=1
                     /product="ATP synthase membrane subunit K, mitochondrial"
                     /protein_id="XP_022210589.1"
                     /db_xref="GeneID:111066357"
                     /translation="MAGEGEKLTGLSKIFNGSTMSGRANVAKATYAVMGLVIAYQILK
                     PKKK"
     misc_feature    66..206
                     /gene="LOC111066357"
                     /note="ATP synthase regulation; Region: ATP_synth_reg;
                     pfam14960"
                     /db_xref="CDD:434349"
ORIGIN      
        1 tcgatggttt gacacctcta ttatataatt attttattcc gtgaaaaacc tgaaagctgg
       61 aaacaatggc tggtgaaggc gagaaactga ccggcttgtc gaaaatattc aatggctcga
      121 ccatgagcgg acgcgccaat gtggccaagg ctacatatgc tgtgatggga ctcgtgattg
      181 cctaccagat cctgaagccc aagaagaagt agagggctgc cgttgcctcc ctttgttttc
      241 ttctcgtacc aagtgcttct gcagccccag tcggacccct ggaccgtatg ctcgtgatcc
      301 gaacaccaaa gaacgggcgc cgcaggatcg aggccatgta atttcatgtg cagtgcaaga
      361 ccttgaagga ataaataagt tgaaaattta acacac