Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura endochitinase A (LOC111066344),


LOCUS       XM_022354860            1232 bp    mRNA    linear   INV 14-MAY-2021
            transcript variant X1, mRNA.
ACCESSION   XM_022354860
VERSION     XM_022354860.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354860.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1232
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..1232
                     /gene="LOC111066344"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments,
                     including 2 samples with support for all annotated
                     introns"
                     /db_xref="GeneID:111066344"
     CDS             117..1154
                     /gene="LOC111066344"
                     /codon_start=1
                     /product="endochitinase A isoform X1"
                     /protein_id="XP_022210552.2"
                     /db_xref="GeneID:111066344"
                     /translation="MWQQYFFVIFACLGSGLVGGGNAFWWPRATTPAARPFDFREAPN
                     AQQMLQQIPLTYFRTYTYQPLTGGGPFSVPFFGYGAAQTPLLSPSPHYDPYAVTSYAA
                     ARRHDVAAKTGVTPPAASSSTTTTSTTTPAPTTTTTTTTTTTTPAPTTTTSSTTTPPP
                     PPPHPANGISEGATVGGSYPSSGGGSGATSSLLRYGEYPTYTRRVSNLYNARPQYPYP
                     DYFNNQPQGGLAEPGVGMGVGAGGTRIQFVPCMCPVSVPSLSSSLTGAGAAAAVPAAP
                     AAIGSASSSNPAARHIDSHEMQADAELDADADVDADPEASDDEEDVEEDEGVTAKALP
                     DHQETTSNSPA"
ORIGIN      
        1 agataccccg acaaatatcc aacgaaatac aaattgtttt tttttttttt ttctattaaa
       61 ctcccaaagg atacgggact cgtcctagtg cagtgctagc cattgatatc ccaaaaatgt
      121 ggcaacaata tttttttgtg atcttcgcct gcttggggtc tggcctggtc ggcggtggca
      181 atgccttctg gtggcccagg gccacaaccc ctgctgcacg cccttttgat ttcagggaag
      241 cacccaacgc acagcagatg ctgcagcaga taccgctgac ctacttccgc acatacacgt
      301 accagccgct gactgggggg gggcccttca gcgtgccctt cttcggctac ggagcagctc
      361 agacgccgct cctgtcgccg agtccgcact acgacccgta cgccgtgacc agctacgcgg
      421 ctgcccggcg gcacgatgtc gccgccaaga ctggcgtcac gccgccagct gccagcagct
      481 ccaccaccac caccagcacc accacgcccg ctccaacgac gaccaccacc accaccacga
      541 cgaccaccac tccggcaccg actacaacga ccagcagcac aacgacgccg cctccacctc
      601 ctccacatcc cgcgaatggc atctcagagg gagcgacagt gggaggctcc tacccctcct
      661 cgggcggagg ctctggagcg acatcctccc tgctgcgcta tggagagtat ccgacctaca
      721 cccggcgggt gagcaacctg tacaacgccc gaccgcagta cccgtatccg gactacttca
      781 acaaccagcc gcagggcggg ttggcggagc cgggtgtggg aatgggagtg ggagcgggtg
      841 gcacccgcat ccagtttgtg ccctgcatgt gccccgtcag cgtgcccagc ctgagcagct
      901 ccctcactgg cgctggcgct gccgccgccg ttccagccgc tccagcagcc atcggcagtg
      961 cgtcctcctc caacccggcg gcgcgtcaca tcgacagcca tgagatgcag gcggacgcag
     1021 agttggatgc ggatgcagac gtggacgcag acccagaggc cagtgacgat gaggaggacg
     1081 tggaggagga tgaaggtgtc actgccaaag cactgcccga ccaccaggag acgacatcga
     1141 acagccccgc ttagccaatg gcgctctccc actccatagt attaaaaaaa aaccacacat
     1201 cgactgattt gccagttcta gctatatact ac