Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354851 891 bp mRNA linear INV 14-MAY-2021 (LOC111066334), mRNA. ACCESSION XM_022354851 VERSION XM_022354851.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354851.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..891 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..891 /gene="LOC111066334" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111066334" CDS 226..681 /gene="LOC111066334" /codon_start=1 /product="uncharacterized protein LOC111066334" /protein_id="XP_022210543.1" /db_xref="GeneID:111066334" /translation="MSSLSQWWIASLLCLCLCLCLVPFGEAIECYVCDTSDTEHPFQC GEWFERYDQPDIVPQNCSSVHGAQFCVKHVGRFEGGVGAKRFCSSKDLGNYCEYVRNK GDRMDYRSCIYTCDSDGCNGAVSQLTRPFGNGKWGVAGLMFVLWLIWQR" misc_feature 307..594 /gene="LOC111066334" /note="extracellular domain (ECD) found in Drosophila melanogaster protein boudin and similar proteins; Region: TFP_LU_ECD_Bou; cd23590" /db_xref="CDD:467119" ORIGIN 1 gaaacagcgc ttcagtacac agttcaaacc tggcatttgc tgacgacgct gactacgatt 61 ctcccaaaaa aacgaacgag cgctgctgat tttgttgttg ttgttgttgt ctccgtcacg 121 tcaattcacg tcacgccaag caaccagcgc agcgcagcgc actcccccac cctgccctgc 181 tcagcccccc tgcccgtagc attgtgcaat cgaaggcaat cgagaatgtc atcgctgtcc 241 cagtggtgga tcgcatcgct gctctgcctc tgcctgtgcc tgtgcctggt tccctttggg 301 gaggccatcg agtgctatgt gtgcgacacg agcgacacgg agcatccctt ccagtgcggc 361 gagtggttcg agcggtacga tcagccggac atcgtgcccc aaaactgttc cagcgtccat 421 ggggcccagt tctgtgtgaa gcatgtcggc cgcttcgagg gcggcgttgg tgcgaagcgc 481 ttctgcagct ccaaggatct gggcaactac tgtgaatacg tgcggaacaa gggtgaccgc 541 atggactatc gcagctgcat ctatacctgc gactcggatg ggtgtaatgg cgccgtttcc 601 cagctgacga ggccctttgg caacggtaaa tggggtgtgg ccggcctgat gtttgtgctc 661 tggctcatct ggcaacgctg aagctgtgga gagtagagag tctctgccaa actcagaaaa 721 aaaagagaga gagagagaga tcgcgaacaa agaagctaca ctgtttacgc tgcttctaca 781 cgttgtgcat cgtttttttt tttcgtagta cctaagcttg taatttttaa gttgtaacaa 841 agtaaagtcg agagacaaac acacacaaaa catatatata gagaaacccc a