Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066334


LOCUS       XM_022354851             891 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066334), mRNA.
ACCESSION   XM_022354851
VERSION     XM_022354851.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354851.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..891
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..891
                     /gene="LOC111066334"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 3 Proteins, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111066334"
     CDS             226..681
                     /gene="LOC111066334"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066334"
                     /protein_id="XP_022210543.1"
                     /db_xref="GeneID:111066334"
                     /translation="MSSLSQWWIASLLCLCLCLCLVPFGEAIECYVCDTSDTEHPFQC
                     GEWFERYDQPDIVPQNCSSVHGAQFCVKHVGRFEGGVGAKRFCSSKDLGNYCEYVRNK
                     GDRMDYRSCIYTCDSDGCNGAVSQLTRPFGNGKWGVAGLMFVLWLIWQR"
     misc_feature    307..594
                     /gene="LOC111066334"
                     /note="extracellular domain (ECD) found in Drosophila
                     melanogaster protein boudin and similar proteins; Region:
                     TFP_LU_ECD_Bou; cd23590"
                     /db_xref="CDD:467119"
ORIGIN      
        1 gaaacagcgc ttcagtacac agttcaaacc tggcatttgc tgacgacgct gactacgatt
       61 ctcccaaaaa aacgaacgag cgctgctgat tttgttgttg ttgttgttgt ctccgtcacg
      121 tcaattcacg tcacgccaag caaccagcgc agcgcagcgc actcccccac cctgccctgc
      181 tcagcccccc tgcccgtagc attgtgcaat cgaaggcaat cgagaatgtc atcgctgtcc
      241 cagtggtgga tcgcatcgct gctctgcctc tgcctgtgcc tgtgcctggt tccctttggg
      301 gaggccatcg agtgctatgt gtgcgacacg agcgacacgg agcatccctt ccagtgcggc
      361 gagtggttcg agcggtacga tcagccggac atcgtgcccc aaaactgttc cagcgtccat
      421 ggggcccagt tctgtgtgaa gcatgtcggc cgcttcgagg gcggcgttgg tgcgaagcgc
      481 ttctgcagct ccaaggatct gggcaactac tgtgaatacg tgcggaacaa gggtgaccgc
      541 atggactatc gcagctgcat ctatacctgc gactcggatg ggtgtaatgg cgccgtttcc
      601 cagctgacga ggccctttgg caacggtaaa tggggtgtgg ccggcctgat gtttgtgctc
      661 tggctcatct ggcaacgctg aagctgtgga gagtagagag tctctgccaa actcagaaaa
      721 aaaagagaga gagagagaga tcgcgaacaa agaagctaca ctgtttacgc tgcttctaca
      781 cgttgtgcat cgtttttttt tttcgtagta cctaagcttg taatttttaa gttgtaacaa
      841 agtaaagtcg agagacaaac acacacaaaa catatatata gagaaacccc a