Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354849 988 bp mRNA linear INV 14-MAY-2021 (LOC111066331), mRNA. ACCESSION XM_022354849 VERSION XM_022354849.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354849.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..988 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..988 /gene="LOC111066331" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111066331" CDS 133..735 /gene="LOC111066331" /codon_start=1 /product="uncharacterized protein LOC111066331" /protein_id="XP_022210541.2" /db_xref="GeneID:111066331" /translation="MDRILLVFCLFLCLDCLMATEEMENFIPERCRYLKSHEEVLQRK CSGHYPLVAVTKFRDTFIEAGEPFALYMTASLDYVLVLMKASPLHNCQKMRFLDVKSF NCLSRGEDENNTVLLDSAAMYCFPFHIQLPDDLMQMCLMENEMGSDPLTDVLKTKRGV IHYALGDNGAIGIGPASLRLLLALPLSICMAATLRAFADH" ORIGIN 1 taatcagatt caggtatctg ttaatgaaaa tatataaaaa tccaaatact cacacatgta 61 caaacacaca acacacatgg acatatcggc atacacatat agtaactaat aaattctctt 121 tggctgaatc gaatggaccg aattctgttg gttttctgcc tatttctctg ccttgactgt 181 ttgatggcca ccgaggaaat ggaaaatttt ataccagagc gttgtcgcta cttgaaatcg 241 cacgaggagg tcctgcagcg gaaatgctcc ggccactatc ccctggtggc ggtcaccaaa 301 ttccgggaca catttatcga ggctggcgaa ccattcgccc tgtacatgac cgcctcgctg 361 gactatgtgc tggtgctgat gaaggcctcg ccgctgcaca actgccaaaa gatgcgcttc 421 ctggacgtga agagtttcaa ctgcctgagc cggggcgagg atgagaacaa cacggtgctg 481 ctggacagcg cggctatgta ctgcttcccg ttccacatcc agctgcccga cgatctcatg 541 cagatgtgcc tcatggagaa cgagatgggc tcggatccgc tcacagatgt gctcaaaacg 601 aaacgcggtg tcatccacta tgccctcggc gacaatgggg ccattggcat tggccccgca 661 tcgcttcgac tcctcctggc tctgccattg tccatctgca tggcagcgac tttaagggcg 721 ttcgccgatc actgatcact gattcggttt gaatcataat gcgagtcata aacatttatg 781 tggctaccca taaagcttaa tcggacgggg cggggaagca cagaaaaaaa agaaaaaatt 841 aaaaaaatta caaaccaacc aacaaaatat gatgtgaaaa cgattcaatt tgaatctgga 901 ttattttatc gcccggcctt gaaagtttca gcattattta ctttaattta aatcaaaaat 961 caacaacaac aaaataaacc aaaattaa