Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066331


LOCUS       XM_022354849             988 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066331), mRNA.
ACCESSION   XM_022354849
VERSION     XM_022354849.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354849.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..988
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..988
                     /gene="LOC111066331"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111066331"
     CDS             133..735
                     /gene="LOC111066331"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066331"
                     /protein_id="XP_022210541.2"
                     /db_xref="GeneID:111066331"
                     /translation="MDRILLVFCLFLCLDCLMATEEMENFIPERCRYLKSHEEVLQRK
                     CSGHYPLVAVTKFRDTFIEAGEPFALYMTASLDYVLVLMKASPLHNCQKMRFLDVKSF
                     NCLSRGEDENNTVLLDSAAMYCFPFHIQLPDDLMQMCLMENEMGSDPLTDVLKTKRGV
                     IHYALGDNGAIGIGPASLRLLLALPLSICMAATLRAFADH"
ORIGIN      
        1 taatcagatt caggtatctg ttaatgaaaa tatataaaaa tccaaatact cacacatgta
       61 caaacacaca acacacatgg acatatcggc atacacatat agtaactaat aaattctctt
      121 tggctgaatc gaatggaccg aattctgttg gttttctgcc tatttctctg ccttgactgt
      181 ttgatggcca ccgaggaaat ggaaaatttt ataccagagc gttgtcgcta cttgaaatcg
      241 cacgaggagg tcctgcagcg gaaatgctcc ggccactatc ccctggtggc ggtcaccaaa
      301 ttccgggaca catttatcga ggctggcgaa ccattcgccc tgtacatgac cgcctcgctg
      361 gactatgtgc tggtgctgat gaaggcctcg ccgctgcaca actgccaaaa gatgcgcttc
      421 ctggacgtga agagtttcaa ctgcctgagc cggggcgagg atgagaacaa cacggtgctg
      481 ctggacagcg cggctatgta ctgcttcccg ttccacatcc agctgcccga cgatctcatg
      541 cagatgtgcc tcatggagaa cgagatgggc tcggatccgc tcacagatgt gctcaaaacg
      601 aaacgcggtg tcatccacta tgccctcggc gacaatgggg ccattggcat tggccccgca
      661 tcgcttcgac tcctcctggc tctgccattg tccatctgca tggcagcgac tttaagggcg
      721 ttcgccgatc actgatcact gattcggttt gaatcataat gcgagtcata aacatttatg
      781 tggctaccca taaagcttaa tcggacgggg cggggaagca cagaaaaaaa agaaaaaatt
      841 aaaaaaatta caaaccaacc aacaaaatat gatgtgaaaa cgattcaatt tgaatctgga
      901 ttattttatc gcccggcctt gaaagtttca gcattattta ctttaattta aatcaaaaat
      961 caacaacaac aaaataaacc aaaattaa