Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066327


LOCUS       XM_022354840             962 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066327), mRNA.
ACCESSION   XM_022354840
VERSION     XM_022354840.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354840.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..962
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..962
                     /gene="LOC111066327"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 100% coverage of
                     the annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111066327"
     CDS             71..889
                     /gene="LOC111066327"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066327"
                     /protein_id="XP_022210532.2"
                     /db_xref="GeneID:111066327"
                     /translation="MPRVPYTWRQPDFPGDGSDLAWLQPTLLIICPKANLEKAIEPLL
                     RTLKQPLAPRTVAAVCVHETMRSAFQEKVCQSLEMLHTQVQSHDYYARALRTIGCLRA
                     ETVGLQQTDKIGFQSKLARGSPVLVCGFDQSFFSMKHPSTVVTLHTFRHALELPQVVA
                     RERLSFASAAIWGGKMCDIYEVALQLPVIRTVYLNCHAVPLAPIEQYFAARQPHVVMA
                     NHHHFEVLLHEERAWIIVYPARVEWHPSIKPRTTMSFTEPPLILKGKDVRMPQP"
     misc_feature    131..787
                     /gene="LOC111066327"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:448367"
ORIGIN      
        1 tctctacaac ttgttcagcc ccccacccca attgagtttg cgttaaattc tagagtttga
       61 aatttgaaaa atgccccgcg tgccgtacac ttggcgccag ccggacttcc ctggcgatgg
      121 cagcgatctg gcctggctgc agcccacgct gctcatcatt tgccccaagg ccaatctgga
      181 gaaggccata gagccgctgc tgcgcaccct caagcagccg ctcgcgcccc gcactgtggc
      241 ggccgtctgc gtgcacgaga cgatgcgctc ggccttccag gagaaggtct gccagtcgct
      301 ggaaatgctg cacacccagg tgcagagcca cgactactat gcgcgggcac tgcgcaccat
      361 tggctgtctg cgcgcggaga cggtgggcct gcagcagacc gacaagattg gcttccagag
      421 caagctggcc cgcggctcgc cggtgctcgt gtgcggcttc gatcagagct tctttagcat
      481 gaagcatccc agcactgtgg tgacgctgca cacctttcgg catgccctcg agctgcccca
      541 ggtggtggcc agggagcggc tgagcttcgc cagtgcggcc atctggggcg gcaagatgtg
      601 cgacatctac gaggtggccc tccagctgcc ggtcatccgg acggtgtacc tcaactgcca
      661 tgcggtgccg ctggcgccca tcgagcagta cttcgcggcc cgccagccgc acgtcgtcat
      721 ggccaatcac catcacttcg aggtgctgct gcacgaggag cgcgcctgga tcattgtcta
      781 tccggccagg gtcgagtggc atccgtccat caagccgcgt accacaatgt cgttcacaga
      841 gccgccgctg attctgaagg ggaaggacgt tcgcatgccc caaccttgat cccccaatat
      901 tatttgtccc ccgacttggg agaataaatt ccgtttaccc gaatctgtaa gttgatcttt
      961 ta