Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354840 962 bp mRNA linear INV 14-MAY-2021 (LOC111066327), mRNA. ACCESSION XM_022354840 VERSION XM_022354840.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354840.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..962 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..962 /gene="LOC111066327" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments" /db_xref="GeneID:111066327" CDS 71..889 /gene="LOC111066327" /codon_start=1 /product="uncharacterized protein LOC111066327" /protein_id="XP_022210532.2" /db_xref="GeneID:111066327" /translation="MPRVPYTWRQPDFPGDGSDLAWLQPTLLIICPKANLEKAIEPLL RTLKQPLAPRTVAAVCVHETMRSAFQEKVCQSLEMLHTQVQSHDYYARALRTIGCLRA ETVGLQQTDKIGFQSKLARGSPVLVCGFDQSFFSMKHPSTVVTLHTFRHALELPQVVA RERLSFASAAIWGGKMCDIYEVALQLPVIRTVYLNCHAVPLAPIEQYFAARQPHVVMA NHHHFEVLLHEERAWIIVYPARVEWHPSIKPRTTMSFTEPPLILKGKDVRMPQP" misc_feature 131..787 /gene="LOC111066327" /note="NAD(P)+-dependent aldehyde dehydrogenase superfamily; Region: ALDH-SF; cl11961" /db_xref="CDD:448367" ORIGIN 1 tctctacaac ttgttcagcc ccccacccca attgagtttg cgttaaattc tagagtttga 61 aatttgaaaa atgccccgcg tgccgtacac ttggcgccag ccggacttcc ctggcgatgg 121 cagcgatctg gcctggctgc agcccacgct gctcatcatt tgccccaagg ccaatctgga 181 gaaggccata gagccgctgc tgcgcaccct caagcagccg ctcgcgcccc gcactgtggc 241 ggccgtctgc gtgcacgaga cgatgcgctc ggccttccag gagaaggtct gccagtcgct 301 ggaaatgctg cacacccagg tgcagagcca cgactactat gcgcgggcac tgcgcaccat 361 tggctgtctg cgcgcggaga cggtgggcct gcagcagacc gacaagattg gcttccagag 421 caagctggcc cgcggctcgc cggtgctcgt gtgcggcttc gatcagagct tctttagcat 481 gaagcatccc agcactgtgg tgacgctgca cacctttcgg catgccctcg agctgcccca 541 ggtggtggcc agggagcggc tgagcttcgc cagtgcggcc atctggggcg gcaagatgtg 601 cgacatctac gaggtggccc tccagctgcc ggtcatccgg acggtgtacc tcaactgcca 661 tgcggtgccg ctggcgccca tcgagcagta cttcgcggcc cgccagccgc acgtcgtcat 721 ggccaatcac catcacttcg aggtgctgct gcacgaggag cgcgcctgga tcattgtcta 781 tccggccagg gtcgagtggc atccgtccat caagccgcgt accacaatgt cgttcacaga 841 gccgccgctg attctgaagg ggaaggacgt tcgcatgccc caaccttgat cccccaatat 901 tatttgtccc ccgacttggg agaataaatt ccgtttaccc gaatctgtaa gttgatcttt 961 ta