Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura uncharacterized LOC111066305


LOCUS       XM_022354791             613 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066305), mRNA.
ACCESSION   XM_022354791
VERSION     XM_022354791.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354791.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..613
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..613
                     /gene="LOC111066305"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 11 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111066305"
     CDS             91..468
                     /gene="LOC111066305"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066305"
                     /protein_id="XP_022210483.2"
                     /db_xref="GeneID:111066305"
                     /translation="MDKLKTSAMDDFGSATCHSRGDMVEVYENETRVVWLNPNQRSAS
                     GKKVANIFVENSKKIAMKQLKTKVSWQRTAHGTYQRKLVIDDKALETKTGDLAVASKD
                     SNCCGDAGFLSDKNLDNKMQKKV"
ORIGIN      
        1 tacgttgact aaatcagttt tcccttaccc atccagtaat aaacaacaaa atatattttt
       61 tcgatttttg aaacattcaa aaaattttcc atggataaac taaaaacttc tgcaatggac
      121 gattttgggt cggcgacgtg ccacagccgt ggcgatatgg tggaggtata cgaaaacgaa
      181 actcgcgttg tctggctgaa cccaaatcag cgatctgcat ccgggaagaa ggtggccaac
      241 atattcgttg aaaattctaa aaaaatagca atgaagcaac tgaaaactaa agtctcttgg
      301 caacgtactg cccacgggac ttaccaacga aaactggtga tcgacgacaa ggctctggaa
      361 acgaaaactg gagacctggc cgtggcttcc aaggattcga actgctgtgg agatgcggga
      421 tttttgagtg acaaaaatct ggacaacaaa atgcagaaga aagtgtagtg cgccatgcgg
      481 agaagaaacc tggcgggggc atgtctgcgt cgaccaaaaa gtcctcttcc aaaattgttt
      541 aattcttgca gtaattattt caaacgctgt gccaatcaga aagtatccga ttaaagcaca
      601 agcgtaaact ata