PREDICTED: Drosophila obscura uncharacterized LOC111066303

LOCUS       XM_022354789             759 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066303), mRNA.
ACCESSION   XM_022354789
VERSION     XM_022354789.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354789.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..759
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..759
                     /gene="LOC111066303"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 7 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111066303"
     CDS             133..582
                     /gene="LOC111066303"
                     /codon_start=1
                     /product="uncharacterized protein LOC111066303"
                     /protein_id="XP_022210481.1"
                     /db_xref="GeneID:111066303"
                     /translation="MSGVMNQQNCDKINRRLYNRGAPNAGRNELPVMAAWPKSLANCP
                     EMAKLSIKPEPITDGHGGGGGGAHVMYRRGQILSIGLLLADQLADPKTENQIWPLCNE
                     VKKRLRSVGIYKNRLVAPPSVFTTECAGDPGAIGCGNWRLNGGRFSN"
ORIGIN      
        1 gtgctaacca agtcaactac atcgtttgga atcttttttt tttttttgat tttttatata
       61 catttttccg tgcaaggaaa ttacttttcg aatatacaca aaagaacagc cttaggcaca
      121 cgcttgaatt gaatgtccgg cgtgatgaac cagcaaaatt gcgacaagat caacaggagg
      181 ctctacaaca ggggggcacc caatgccggt cgcaacgagc taccagtgat ggccgcctgg
      241 cccaagtcac tggccaactg ccctgagatg gccaagcttt cgatcaagcc agagccaata
      301 accgatggac acggaggcgg tggcggcggt gcacatgtca tgtaccgtcg cggtcagatt
      361 ctatccattg gtcttctatt ggccgatcaa ttggccgatc caaagactga aaatcagatc
      421 tggccattgt gcaatgaggt gaagaagcgc cttcgctctg ttggcatcta taagaatcgc
      481 ttggtcgctc ccccatcagt ttttacaacc gaatgcgctg gcgatccagg cgcaattggc
      541 tgtggcaatt ggaggctcaa tgggggtcga ttctccaatt agtgggggca gaagctcaat
      601 ttccccgccc cccacacaca tttcgaatac ttcctccaca atagattcca tcttggccac
      661 acacaaaatt atgatatttt atatcgcagt ttccttgtaa aatctcaaat taaattgttc
      721 cttagttatg caaattaaaa acatatgtat gtctgtgat