Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]
LOCUS XM_022354787 929 bp mRNA linear INV 14-MAY-2021 (LOC111066302), mRNA. ACCESSION XM_022354787 VERSION XM_022354787.2 DBLINK BioProject: PRJNA728747 KEYWORDS RefSeq. SOURCE Drosophila obscura ORGANISM Drosophila obscura Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta; Pterygota; Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_024542752.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process On May 14, 2021 this sequence version replaced XM_022354787.1. ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Name :: Drosophila obscura Annotation Release 101 Annotation Version :: 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 8.6 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## FEATURES Location/Qualifiers source 1..929 /organism="Drosophila obscura" /mol_type="mRNA" /isolate="BZ-5 IFL" /db_xref="taxon:7282" /chromosome="Unknown" /sex="male" /tissue_type="whole fly" /dev_stage="Adult fly" /geo_loc_name="Serbia: Babin Zub" /collection_date="2017" gene 1..929 /gene="LOC111066302" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 6 samples with support for all annotated introns" /db_xref="GeneID:111066302" CDS 162..887 /gene="LOC111066302" /codon_start=1 /product="proteasome subunit alpha type-6-like" /protein_id="XP_022210479.2" /db_xref="GeneID:111066302" /translation="MPRLTAGLDEQITIFSPSGDLHQIDFAKKAVALENTTVALKTEH TAVLATQKRIADKTIVLQSVRHLWATTPKIGCCMTGRIADSRYQVRWALNEATKFRYA CGYDIPARALCERIADMNQLYSMHPEIRPLGCSMIMIDYDENEPTLHMTDPSGDFNSY KGCALGPHADKAEAYLVKHYKHYLPQEQTIQLAINCLCTAMDIAFEPLHLEVGLVSKD HPEFRILDEQEIALHIQNIMLSQ" misc_feature 180..806 /gene="LOC111066302" /note="The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid. N-terminal nucleophile (NTN-) hydrolase superfamily, which contains a...; Region: Ntn_hydrolase; cl00467" /db_xref="CDD:469781" ORIGIN 1 gcatagtttt aattagcacc ttgacaacag agcatcctac tcagtggagc cgtaagcatt 61 aaaaataaag gtcttggcat tgtgatatta ccgttcaaaa ctgttcaact aatcttcact 121 ttggcagctg aaaagttttc aaattgttga ggcttccaaa aatgccgcgt ttgacagcag 181 gacttgatga gcagatcacc atcttctcgc catcgggcga tttacatcag attgactttg 241 ccaagaaagc cgtggccttg gagaacacca cagtggccct gaagactgaa cacacggcag 301 ttttggccac ccagaagcga attgccgaca agaccatcgt actgcagtcg gtgaggcatt 361 tgtgggccac caccccaaag attggctgct gcatgaccgg tcgcatcgcc gactcgcgct 421 atcaagtgcg gtgggccctt aacgaggcca caaaattccg atacgcatgc ggctacgata 481 taccggcacg ggcgctgtgc gaacgcattg cggacatgaa tcagctgtac tcgatgcatc 541 ccgaaatccg tccgctcggc tgcagcatga ttatgatcga ctacgacgaa aacgaaccca 601 cgctgcacat gacagatccc tctggggact tcaacagcta caagggctgt gcgctggggc 661 cgcacgctga caaggccgaa gcgtacctgg taaagcacta caagcactat ttgccgcagg 721 agcagaccat ccagctggcc attaattgcc tgtgcactgc catggatatt gcgtttgagc 781 cactgcactt ggaagtgggc ctcgtgagca aggatcatcc ggagtttcgt attctggatg 841 agcaggagat tgccttgcat atccaaaata tcatgctgtc tcaataatgt gccatacacc 901 caatacacaa cattacatac tgcaggagg