Unfortunately due to lack of commercial feasibility, the SkyBLAST service has been suspended from December 1st, 2025.
All subscriptions for paid accounts have been paused. For further information or enquiries, please email [email protected]

PREDICTED: Drosophila obscura proteasome subunit alpha type-6-like


LOCUS       XM_022354787             929 bp    mRNA    linear   INV 14-MAY-2021
            (LOC111066302), mRNA.
ACCESSION   XM_022354787
VERSION     XM_022354787.2
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542752.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            On May 14, 2021 this sequence version replaced XM_022354787.1.
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..929
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..929
                     /gene="LOC111066302"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 6 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:111066302"
     CDS             162..887
                     /gene="LOC111066302"
                     /codon_start=1
                     /product="proteasome subunit alpha type-6-like"
                     /protein_id="XP_022210479.2"
                     /db_xref="GeneID:111066302"
                     /translation="MPRLTAGLDEQITIFSPSGDLHQIDFAKKAVALENTTVALKTEH
                     TAVLATQKRIADKTIVLQSVRHLWATTPKIGCCMTGRIADSRYQVRWALNEATKFRYA
                     CGYDIPARALCERIADMNQLYSMHPEIRPLGCSMIMIDYDENEPTLHMTDPSGDFNSY
                     KGCALGPHADKAEAYLVKHYKHYLPQEQTIQLAINCLCTAMDIAFEPLHLEVGLVSKD
                     HPEFRILDEQEIALHIQNIMLSQ"
     misc_feature    180..806
                     /gene="LOC111066302"
                     /note="The Ntn hydrolases (N-terminal nucleophile) are a
                     diverse superfamily of of enzymes that are activated
                     autocatalytically via an N-terminally lcated nucleophilic
                     amino acid. N-terminal nucleophile (NTN-) hydrolase
                     superfamily, which contains a...; Region: Ntn_hydrolase;
                     cl00467"
                     /db_xref="CDD:469781"
ORIGIN      
        1 gcatagtttt aattagcacc ttgacaacag agcatcctac tcagtggagc cgtaagcatt
       61 aaaaataaag gtcttggcat tgtgatatta ccgttcaaaa ctgttcaact aatcttcact
      121 ttggcagctg aaaagttttc aaattgttga ggcttccaaa aatgccgcgt ttgacagcag
      181 gacttgatga gcagatcacc atcttctcgc catcgggcga tttacatcag attgactttg
      241 ccaagaaagc cgtggccttg gagaacacca cagtggccct gaagactgaa cacacggcag
      301 ttttggccac ccagaagcga attgccgaca agaccatcgt actgcagtcg gtgaggcatt
      361 tgtgggccac caccccaaag attggctgct gcatgaccgg tcgcatcgcc gactcgcgct
      421 atcaagtgcg gtgggccctt aacgaggcca caaaattccg atacgcatgc ggctacgata
      481 taccggcacg ggcgctgtgc gaacgcattg cggacatgaa tcagctgtac tcgatgcatc
      541 ccgaaatccg tccgctcggc tgcagcatga ttatgatcga ctacgacgaa aacgaaccca
      601 cgctgcacat gacagatccc tctggggact tcaacagcta caagggctgt gcgctggggc
      661 cgcacgctga caaggccgaa gcgtacctgg taaagcacta caagcactat ttgccgcagg
      721 agcagaccat ccagctggcc attaattgcc tgtgcactgc catggatatt gcgtttgagc
      781 cactgcactt ggaagtgggc ctcgtgagca aggatcatcc ggagtttcgt attctggatg
      841 agcaggagat tgccttgcat atccaaaata tcatgctgtc tcaataatgt gccatacacc
      901 caatacacaa cattacatac tgcaggagg